LXL04_031345 | RubberDandelionOmics

Gene overview

LXL04_031345

Reference: OH-1004 Chr: Chr07 Coordinates: 4830708-4831471 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · LXL04_031345|LXL04_031345|OH1004|cDNA

ATGGCCGCAATGATGAATTCTAGTGTTTTAGCCTGCAACTATGCAGTCTCCGGCGGTCTCGCTTCACCGGACTTCAACTCAAAGCCTTCCTCCTCCGTCAGTTACAAGTTGCCGGTCATCAAGGCTAAGCAGAATGTAACATCATCGTCTGCAGATTCCAAGGATCAGTCGCAGCAGGGAAGAAGAGCCGCTCTACTTGCTCTCGGAGCTGCACTCTTTGCCACCGCCACCTCCTCCGCCAACGCCGGCGTCATTGATGA...

CDS

Download CDS FASTA

504 bp · LXL04_031345|LXL04_031345|OH1004|CDS

ATGGCCGCAATGATGAATTCTAGTGTTTTAGCCTGCAACTATGCAGTCTCCGGCGGTCTCGCTTCACCGGACTTCAACTCAAAGCCTTCCTCCTCCGTCAGTTACAAGTTGCCGGTCATCAAGGCTAAGCAGAATGTAACATCATCGTCTGCAGATTCCAAGGATCAGTCGCAGCAGGGAAGAAGAGCCGCTCTACTTGCTCTCGGAGCTGCACTCTTTGCCACCGCCACCTCCTCCGCCAACGCCGGCGTCATTGATGA...

Protein

Download Protein FASTA

167 aa · LXL04_031345|LXL04_031345|OH1004|PROTEIN

MAAMMNSSVLACNYAVSGGLASPDFNSKPSSSVSYKLPVIKAKQNVTSSSADSKDQSQQGRRAALLALGAALFATATSSANAGVIDEYLEKSKANKELNDQKRLATSGANFARAYTVQFGTCTFPYNFTGCQDLAKTKKVPFLSEDLELECKGKDKYKCGSNVFWKW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031345`
TK1151 ID	TkA08G102410
OH-1004 ID	LXL04_031345
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031345

Location Chr07:4830708-4831471 (-)

Description Similar to PSAN: Photosystem I reaction center subunit N, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64040`	May function in mediating the binding of the antenna complexes to the PSI reaction center and core antenna.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031345 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015979 photosynthesis Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009522 photosystem I Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0030093 chloroplast photosystem I Cellular Component

GO:0005516 calmodulin binding Molecular Function

GO:0019904 protein domain specific binding Molecular Function

KEGG gene cross-reference

ath:AT5G64040

vcn:VOLCADRAFT_109887

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.987

Rank 1 · LXL04_031345 · OH-1004

Mitochondrion0.016

Rank 2 · LXL04_031345 · OH-1004

Nucleus0.010

Rank 3 · LXL04_031345 · OH-1004

Cytoplasm0.009

Rank 4 · LXL04_031345 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_031345 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05479.17PsaN39-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031345	`PF05479.17`	PsaN	39	167	1.4e-62	210.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P49107`	Arabidopsis thaliana	Photosystem I reaction center subunit N, chloroplastic	64.205%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card