LXL04_031336 | RubberDandelionOmics

Gene overview

LXL04_031336

Reference: OH-1004 Chr: Chr07 Coordinates: 4713385-4716112 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2478 bp · LXL04_031336|LXL04_031336|OH1004|cDNA

ATGGGCTGCGGAGGTTCTAAAATCGACGATTTGCCATTGGTGATACGTTGTAGAGCTAGAAAGGAAATGATCAGGTCTGCGATGGACTACCGGTATGATTTGTCTTCTTCACATGTCGCTTATTTCCGATCTCTTACGGACATCAGCGATGCACTGTCTCGATTTGTTGATGAAGAACTCGTAGTCAATTCATTCTCTGCGTCTTCCCCTGTACTCACATTACCATCTGATGAAAGTTCCATTTCACATATTCATTCCAT...

CDS

Download CDS FASTA

2478 bp · LXL04_031336|LXL04_031336|OH1004|CDS

ATGGGCTGCGGAGGTTCTAAAATCGACGATTTGCCATTGGTGATACGTTGTAGAGCTAGAAAGGAAATGATCAGGTCTGCGATGGACTACCGGTATGATTTGTCTTCTTCACATGTCGCTTATTTCCGATCTCTTACGGACATCAGCGATGCACTGTCTCGATTTGTTGATGAAGAACTCGTAGTCAATTCATTCTCTGCGTCTTCCCCTGTACTCACATTACCATCTGATGAAAGTTCCATTTCACATATTCATTCCAT...

Protein

Download Protein FASTA

825 aa · LXL04_031336|LXL04_031336|OH1004|PROTEIN

MGCGGSKIDDLPLVIRCRARKEMIRSAMDYRYDLSSSHVAYFRSLTDISDALSRFVDEELVVNSFSASSPVLTLPSDESSISHIHSIDGNEDSHLHLSSDSESDLHSYSGSHIHIVDDDSVPRNESKSPLSSLYNHNQNNWDNGFVLNGDPPSYSGGWGPYGGIFYPQSRSSNFYYMKKSAPASNTVLHKEERGFQQTGQWPDSSQYNPNLHESGSFYGFSMNRSSPPEESKQQKPTKTPSPPPPPKVNAWDFFNFFDGY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031336`
TK1151 ID	TkA08G101940
OH-1004 ID	LXL04_031336
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 98.608 / OH-1004 60.121 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031336

Location Chr07:4713385-4716112 (-)

Description Similar to APSR1: Protein ALTERED PHOSPHATE STARVATION RESPONSE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51290`	Required for the coordination of cell differentiation and cell elongation in the root tip.	No verified direct reference in this release
`At3g60320`	Required for nitrate signaling.	The Arabidopsis NRG2 Protein Mediates Nitrate Signaling and Interacts with and Regulates Key Nitrate Regulators.2016 · DOI: 10.1105/tpc.15.00567

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0562700`	Involved in the regulation of leaf shape formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031336 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010167 response to nitrate Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0030154 cell differentiation Biological Process

GO:0071249 cellular response to nitrate Biological Process

GO:0071705 nitrogen compound transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G51290

ath:AT3G60320

dosa:Os10g0562700

osa:4349394

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.398

Rank 1 · LXL04_031336 · OH-1004

Cytoplasm0.394

Rank 2 · LXL04_031336 · OH-1004

Nucleus0.288

Rank 3 · LXL04_031336 · OH-1004

Endoplasmic reticulum0.055

Rank 4 · LXL04_031336 · OH-1004

Plastid0.047

Rank 5 · LXL04_031336 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04783.18DUF6301-59 aa

PF04782.18DUF632396-713 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031336	`PF04783.18`	DUF630	1	59	7.8e-22	77.9
LXL04_031336	`PF04782.18`	DUF632	396	713	9.1e-80	269.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A178VBJ0`	Arabidopsis thaliana	Protein ALTERED PHOSPHATE STARVATION RESPONSE 1	25.843%	Swiss-Prot	weak database homology
`Q93YU8`	Arabidopsis thaliana	Nitrate regulatory gene2 protein	25.054%	Swiss-Prot	weak database homology
`Q9AQW1`	Oryza sativa subsp. japonica	Protein ROLLING AND ERECT LEAF 2	25.056%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card