Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2448 bp · LXL04_031328|LXL04_031328|OH1004|cDNA
ATGGACCCGCCGGAGTTACCTGAGTGTCCAGTCTGCCTCCAGCCCTTCGACGCCGAATCCACAACCCCACGCGTCCTCGCCTGCGGTCACTCTACCTGCGAAACATGCCTGATCGACCTTCCAAAACCACCTTTCCCTCGTACTATACGCTGCCCGGCTTGTACCCAGCTTGTCCCCTACCCACCACAAGGTCCCTCCGCCCTCCCCAAAAACATCGACCTACTCCGCATCTCCTCCTCTCTTCTTCAATCAAACCCCAA...
2448 bp · LXL04_031328|LXL04_031328|OH1004|CDS
ATGGACCCGCCGGAGTTACCTGAGTGTCCAGTCTGCCTCCAGCCCTTCGACGCCGAATCCACAACCCCACGCGTCCTCGCCTGCGGTCACTCTACCTGCGAAACATGCCTGATCGACCTTCCAAAACCACCTTTCCCTCGTACTATACGCTGCCCGGCTTGTACCCAGCTTGTCCCCTACCCACCACAAGGTCCCTCCGCCCTCCCCAAAAACATCGACCTACTCCGCATCTCCTCCTCTCTTCTTCAATCAAACCCCAA...
Protein
Download Protein FASTA815 aa · LXL04_031328|LXL04_031328|OH1004|PROTEIN
MDPPELPECPVCLQPFDAESTTPRVLACGHSTCETCLIDLPKPPFPRTIRCPACTQLVPYPPQGPSALPKNIDLLRISSSLLQSNPNRLNSKPKTSIVSSPDFIPNFWSREFYCNWKPWIVPRDTVSVDKSVALDEAFLLGTVVNPDASSGEVSSRCSMKIHQKVSLFKIGSFTHSNENRFSYSYLAKAISILFKMSDGALAELSLILTSSSMEYRICTSYGLWYNEENERLYIVCEKKQSTLLNAIVSDIQFQDDISTF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_031328 |
|---|---|
| TK1151 ID | TkA08G101560 |
| OH-1004 ID | LXL04_031328 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 99.232 / OH-1004 95.092Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_031328 |
|---|---|
| Location | Chr07:4576428-4579170 (+) |
| Description | Similar to lin-23: F-box/WD repeat-containing protein lin-23 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000209 protein polyubiquitination Biological Process GO:0006508 proteolysis Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0008285 negative regulation of cell population proliferation Biological Process GO:0010826 negative regulation of centrosome duplication Biological Process GO:0016055 Wnt signaling pathway Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:0031647 regulation of protein stability Biological Process GO:0051301 cell division Biological Process GO:0051726 regulation of cell cycle Biological Process GO:0061136 regulation of proteasomal protein catabolic process Biological Process |
| KEGG gene cross-reference | ana:alr3466 cel:CELE_K10B2.1 dre:406825 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14634.13zf-RING_58-55 aaPF13445.13zf-RING_UBOX9-52 aaPF00069.32Pkinase351-445 aaPF24817.2WD40_WDHD1_1st483-594 aaPF24807.2WD40_CDC20-Fz516-581 aaPF25172.2Beta-prop_WDR3_2nd517-683 aaPF25175.2Beta-prop_WDR5518-594 aaPF25173.2Beta-prop_WDR3_1st519-592 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_031328 | PF14634.13 | zf-RING_5 | 8 | 55 | 1.6e-06 | 28.7 |
| LXL04_031328 | PF13445.13 | zf-RING_UBOX | 9 | 52 | 2.6e-07 | 31.2 |
| LXL04_031328 | PF00069.32 | Pkinase | 351 | 445 | 4.7e-07 | 30.2 |
| LXL04_031328 | PF24817.2 | WD40_WDHD1_1st | 483 | 594 | 1.2e-19 | 71.4 |
| LXL04_031328 | PF24807.2 | WD40_CDC20-Fz | 516 | 581 | 2.2e-17 | 64.0 |
| LXL04_031328 | PF25172.2 | Beta-prop_WDR3_2nd | 517 | 683 | 3.2e-13 | 50.3 |
| LXL04_031328 | PF25175.2 | Beta-prop_WDR5 | 518 | 594 | 1.6e-22 | 80.9 |
| LXL04_031328 | PF25173.2 | Beta-prop_WDR3_1st | 519 | 592 | 2.1e-23 | 83.7 |
| LXL04_031328 | PF23381.2 | Beta-prop_IFT122_1st | 520 | 593 | 4.2e-21 | 76.2 |
| LXL04_031328 | PF25047.1 | Beta-prop_TEP1_2nd | 521 | 593 | 2.3e-14 | 53.9 |
| LXL04_031328 | PF25391.2 | WD40_Gbeta | 531 | 680 | 1.9e-09 | 37.7 |
| LXL04_031328 | PF25174.2 | Beta-prop_THOC3 | 535 | 594 | 1.1e-21 | 77.8 |
| LXL04_031328 | PF24814.2 | WD40_Prp19 | 535 | 593 | 3.3e-16 | 59.9 |
| LXL04_031328 | PF23414.2 | Beta-prop_EML_2 | 537 | 665 | 2.6e-10 | 40.8 |
| LXL04_031328 | PF23409.2 | Beta-prop_EML | 540 | 681 | 3e-08 | 34.2 |
| LXL04_031328 | PF25171.2 | Beta-prop_WDR36-Utp21_1st | 554 | 641 | 2.9e-07 | 30.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.