LXL04_031322 | RubberDandelionOmics

Gene overview

LXL04_031322

Reference: OH-1004 Chr: Chr07 Coordinates: 4514424-4517410 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1139 bp · LXL04_031322|LXL04_031322|OH1004|cDNA

ATGGCGATGGAGAAGTGTTTCCAAATGGCTACTCCCAGAGCTTGCGTTCTACAACACTCTCAGCGTTTGTTTGCAACTTCCAAGGATAAACCCTCCTTCACCAACATGTTGAAGCCTCCGATGAAAGCTTCCTCCTTGTCGACTTCCCTTTCGTTCAACCGCAGGTCCCTCATTGTCTGCAAAGCTGCTGTAAATCAAGTTCAAGTGGTAACAGACGTGACTTGGAGCGAATTGGTGGAAGGAGCAGAAATGCCGGTGTT...

CDS

Download CDS FASTA

1098 bp · LXL04_031322|LXL04_031322|OH1004|CDS

ATGGCGATGGAGAAGTGTTTCCAAATGGCTACTCCCAGAGCTTGCGTTCTACAACACTCTCAGCGTTTGTTTGCAACTTCCAAGGATAAACCCTCCTTCACCAACATGTTGAAGCCTCCGATGAAAGCTTCCTCCTTGTCGACTTCCCTTTCGTTCAACCGCAGGTCCCTCATTGTCTGCAAAGCTGCTGTAAATCAAGTTCAAGTGGTAACAGACGTGACTTGGAGCGAATTGGTGGAAGGAGCAGAAATGCCGGTGTT...

Protein

Download Protein FASTA

365 aa · LXL04_031322|LXL04_031322|OH1004|PROTEIN

MAMEKCFQMATPRACVLQHSQRLFATSKDKPSFTNMLKPPMKASSLSTSLSFNRRSLIVCKAAVNQVQVVTDVTWSELVEGAEMPVLVDFWAPWCGPCRMIAPVVDEIAKEYAGKALCYKINTDDCPNIASKYGIRSIPTVLFFKNGEKKESVIGAVPKSTLCATLDKTYERGTTKSFAIPILIHRLDFTNLNGTAMATEKCFQMGAPRPTILRHPHRCFTSMNNDNPCFIHILKPPIKFSTITSPSPNCRSRSPVVCKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031322`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031322

Location Chr07:4514424-4517410 (+)

Description Similar to Thioredoxin M-type, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0188700`	Thiol-disulfide oxidoreductase probably involved in the redox regulation of chloroplastic enzymes.	Abnormal chloroplast development and growth inhibition in rice thioredoxin m knock-down plants.2008 · DOI: 10.1104/pp.108.123547

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031322 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008047 enzyme activator activity Molecular Function

GO:0015035 protein-disulfide reductase activity Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.979

Rank 1 · LXL04_031322 · OH-1004

Mitochondrion0.034

Rank 2 · LXL04_031322 · OH-1004

Cytoplasm0.018

Rank 3 · LXL04_031322 · OH-1004

Nucleus0.014

Rank 4 · LXL04_031322 · OH-1004

Cell membrane0.011

Rank 5 · LXL04_031322 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085.27Thioredoxin67-167 aa

PF13098.14Thioredoxin_279-168 aa

PF14595.13Thioredoxin_991-160 aa

PF00085.27Thioredoxin265-361 aa

PF13098.14Thioredoxin_2310-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031322	`PF00085.27`	Thioredoxin	67	167	6.8e-51	171.3
LXL04_031322	`PF13098.14`	Thioredoxin_2	79	168	1.6e-16	61.4
LXL04_031322	`PF14595.13`	Thioredoxin_9	91	160	2.7e-07	31.3
LXL04_031322	`PF00085.27`	Thioredoxin	265	361	6.8e-51	171.3
LXL04_031322	`PF13098.14`	Thioredoxin_2	310	363	1.6e-16	61.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZP20`	Oryza sativa subsp. japonica	Thioredoxin M5, chloroplastic	50.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card