LXL04_031284 | RubberDandelionOmics

Gene overview

LXL04_031284

Reference: OH-1004 Chr: Chr07 Coordinates: 4098796-4099738 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

786 bp · LXL04_031284|LXL04_031284|OH1004|cDNA

ATGAAGTGTGTCTCTTGCAAAGACGAGTACGGCACTGCTGATGCCGGCACCTGTAGGGAGTGTTACGAGGAGGCCAGCGAGACTGAGGAAGAACTGAAGCGTGAGATTGAAGAACTGAAATCAAAGGTGAACTTCCTCCGCTTCTGGACCCCATTGGACTCTCGTCCCCATCACTACCACCGATCTATCACTCCATGCTTCACAGACGTACTTCTGGTCGCCTTCGACGAAGATTCCGGCAAACCTGTGACCGATTCCGT...

CDS

Download CDS FASTA

786 bp · LXL04_031284|LXL04_031284|OH1004|CDS

ATGAAGTGTGTCTCTTGCAAAGACGAGTACGGCACTGCTGATGCCGGCACCTGTAGGGAGTGTTACGAGGAGGCCAGCGAGACTGAGGAAGAACTGAAGCGTGAGATTGAAGAACTGAAATCAAAGGTGAACTTCCTCCGCTTCTGGACCCCATTGGACTCTCGTCCCCATCACTACCACCGATCTATCACTCCATGCTTCACAGACGTACTTCTGGTCGCCTTCGACGAAGATTCCGGCAAACCTGTGACCGATTCCGT...

Protein

Download Protein FASTA

261 aa · LXL04_031284|LXL04_031284|OH1004|PROTEIN

MKCVSCKDEYGTADAGTCRECYEEASETEEELKREIEELKSKVNFLRFWTPLDSRPHHYHRSITPCFTDVLLVAFDEDSGKPVTDSVPVAANKAVLASRSPVFRAMLETEMEESLSGTIKLSDVSYDALRAFVHYLYTAEACLDDEMACDLLVLADKYEVKHLKTYCEKYMISKLNWESSLISYSFAHQHNANNLLDASLSLILDNMEKVSKLGEYQELVEKDPRLLVEIYEAYLSKQVNTAAVATPAAVVHESKVTRRI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031284`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031284

Location Chr07:4098796-4099738 (+)

Description Similar to At4g08455: BTB/POZ domain-containing protein At4g08455

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g08455`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031284 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030162 regulation of proteolysis Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0031463 Cul3-RING ubiquitin ligase complex Cellular Component

GO:0031625 ubiquitin protein ligase binding Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0140678 molecular function inhibitor activity Molecular Function

KEGG gene cross-reference

mmu:399675

xla:379868

xla:779391

xtr:394599

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.646

Rank 1 · LXL04_031284 · OH-1004

Nucleus0.333

Rank 2 · LXL04_031284 · OH-1004

Cell membrane0.085

Rank 3 · LXL04_031284 · OH-1004

Mitochondrion0.077

Rank 4 · LXL04_031284 · OH-1004

Endoplasmic reticulum0.066

Rank 5 · LXL04_031284 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00651.38BTB86-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031284	`PF00651.38`	BTB	86	174	2.5e-21	76.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6DBN1`	Arabidopsis thaliana	BTB/POZ domain-containing protein At4g08455	64.228%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card