LXL04_031283 | RubberDandelionOmics

Gene overview

LXL04_031283

Reference: OH-1004 Chr: Chr07 Coordinates: 3992730-3993224 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

495 bp · LXL04_031283|LXL04_031283|OH1004|cDNA

ATGTCTCCAATCAATTGCTACGAATTGCACAAGATTTTCAAAATTCTCGACAAGAACGGTGATGGTCTAGTGAGCATCGAGGAGCTTGAATGGTTTCTCAAGAAAACCGGAGTTCAAATAAGCTTAGAGGAGCTTCAAACCCTAGTTGGTAATACGAGTCTTGATCTCATGGACTTTTGGGTATTTTACGATGTTTTCAACAAGCAAAATGCAAGTGATCATGGCCACTATAGATCAAAAGAGGTGGATCAAGAGATGTT...

CDS

Download CDS FASTA

495 bp · LXL04_031283|LXL04_031283|OH1004|CDS

ATGTCTCCAATCAATTGCTACGAATTGCACAAGATTTTCAAAATTCTCGACAAGAACGGTGATGGTCTAGTGAGCATCGAGGAGCTTGAATGGTTTCTCAAGAAAACCGGAGTTCAAATAAGCTTAGAGGAGCTTCAAACCCTAGTTGGTAATACGAGTCTTGATCTCATGGACTTTTGGGTATTTTACGATGTTTTCAACAAGCAAAATGCAAGTGATCATGGCCACTATAGATCAAAAGAGGTGGATCAAGAGATGTT...

Protein

Download Protein FASTA

164 aa · LXL04_031283|LXL04_031283|OH1004|PROTEIN

MSPINCYELHKIFKILDKNGDGLVSIEELEWFLKKTGVQISLEELQTLVGNTSLDLMDFWVFYDVFNKQNASDHGHYRSKEVDQEMLEGDIVKAFQVFDMNGDGFISSEQLERTLSRLGLWDEHCGKSCRSMIEFYDTNNDGVLDFHEFKNMLLMPMRYDTTST

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031283`
TK1151 ID	TkA08G099350
OH-1004 ID	LXL04_031283
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031283

Location Chr07:3992730-3993224 (+)

Description Similar to CML44: Probable calcium-binding protein CML44

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21550`	Potential calcium sensor.	No verified direct reference in this release
`At4g20780`	Probable calcium sensor that binds calcium in vitro.	Calmodulin-like proteins from Arabidopsis and tomato are involved in host defense against Pseudomonas syringae pv. tomato.2005 · DOI: 10.1007/s11103-005-8395-x The calmodulin-related calcium sensor CML42 plays a role in trichome branching.2009 · DOI: 10.1074/jbc.m109.056770
`At5g44460`	Calcium-binding protein that may mediate calcium-dependent signal during plant defense response.	Calmodulin-like proteins from Arabidopsis and tomato are involved in host defense against Pseudomonas syringae pv. tomato.2005 · DOI: 10.1007/s11103-005-8395-x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0492800`	Potential calcium sensor.	No verified direct reference in this release
`Os12g0228800`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031283 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010091 trichome branching Biological Process

GO:0051592 response to calcium ion Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0061891 calcium ion sensor activity Molecular Function

KEGG gene cross-reference

ath:AT1G21550

ath:AT4G20780

ath:AT5G44460

dosa:Os04g0492800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.573

Rank 1 · LXL04_031283 · OH-1004

Nucleus0.295

Rank 2 · LXL04_031283 · OH-1004

Endoplasmic reticulum0.113

Rank 3 · LXL04_031283 · OH-1004

Cell membrane0.075

Rank 4 · LXL04_031283 · OH-1004

Lysosome / Vacuole0.073

Rank 5 · LXL04_031283 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00036.39EF-hand_18-35 aa

PF13405.13EF-hand_68-37 aa

PF13499.13EF-hand_78-51 aa

PF13202.13EF-hand_511-30 aa

PF24548.2EF_EFCAB10_C90-123 aa

PF00036.39EF-hand_191-117 aa

PF13405.13EF-hand_691-119 aa

PF13202.13EF-hand_591-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031283	`PF00036.39`	EF-hand_1	8	35	1.2e-23	81.6
LXL04_031283	`PF13405.13`	EF-hand_6	8	37	1.6e-21	74.6
LXL04_031283	`PF13499.13`	EF-hand_7	8	51	1.6e-17	64.3
LXL04_031283	`PF13202.13`	EF-hand_5	11	30	1.1e-20	72.8
LXL04_031283	`PF24548.2`	EF_EFCAB10_C	90	123	1.1e-07	32.1
LXL04_031283	`PF00036.39`	EF-hand_1	91	117	1.2e-23	81.6
LXL04_031283	`PF13405.13`	EF-hand_6	91	119	1.6e-21	74.6
LXL04_031283	`PF13202.13`	EF-hand_5	91	109	1.1e-20	72.8
LXL04_031283	`PF13499.13`	EF-hand_7	91	153	1.6e-17	64.3
LXL04_031283	`PF13833.13`	EF-hand_8	106	153	2.3e-07	31.2
LXL04_031283	`PF00036.39`	EF-hand_1	129	153	1.2e-23	81.6
LXL04_031283	`PF13405.13`	EF-hand_6	132	153	1.6e-21	74.6
LXL04_031283	`PF13202.13`	EF-hand_5	133	153	1.1e-20	72.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPK5`	Arabidopsis thaliana	Probable calcium-binding protein CML44	43.506%	Swiss-Prot	moderate database homology
`Q9SVG9`	Arabidopsis thaliana	Calcium-binding protein CML42	37.037%	Swiss-Prot	moderate database homology
`Q9FI19`	Arabidopsis thaliana	Probable calcium-binding protein CML43	33.962%	Swiss-Prot	moderate database homology
`Q0JC44`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML22	36.129%	Swiss-Prot	moderate database homology
`Q2QVI1`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML28	33.533%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card