LXL04_031270 | RubberDandelionOmics

Gene overview

LXL04_031270

Reference: OH-1004 Chr: Chr07 Coordinates: 3713823-3714423 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

482 bp · LXL04_031270|LXL04_031270|OH1004|cDNA

ATGAAAACGGAGGTGAATATGGGAGGTGAGAGTTGGGACGATGAAGATAAAGCCATTGTTGCTGCGGTTCTAGGGTCTAGAGCGTTTGACTACTTGATTTCAAGCTCTGTTTCTAATGAATGCTCGTTAACTTCGTTAGGAAATGACGAGAATCTGCAACACAAGCTCTCAGATCTTGTAGACCACCCAAATTCGGCGAATTTCAGTTGGAATTACGCAATATTTTGGCAAATCTCGAGGTCGAAAACAGGGGATTTGGT...

CDS

Download CDS FASTA

330 bp · LXL04_031270|LXL04_031270|OH1004|CDS

ATGAAAACGGAGGTGAATATGGGAGGTGAGAGTTGGGACGATGAAGATAAAGCCATTGTTGCTGCGGTTCTAGGGTCTAGAGCGTTTGACTACTTGATTTCAAGCTCTGTTTCTAATGAATGCTCGTTAACTTCGTTAGGAAATGACGAGAATCTGCAACACAAGCTCTCAGATCTTGTAGACCACCCAAATTCGGCGAATTTCAGTTGGAATTACGCAATATTTTGGCAAATCTCGAGGTCGAAAACAGGGGATTTGGT...

Protein

Download Protein FASTA

109 aa · LXL04_031270|LXL04_031270|OH1004|PROTEIN

MKTEVNMGGESWDDEDKAIVAAVLGSRAFDYLISSSVSNECSLTSLGNDENLQHKLSDLVDHPNSANFSWNYAIFWQISRSKTGDLVLGWGDGSYRDLKTEKNLKSLEF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031270`
TK1151 ID	TkA08G098620
OH-1004 ID	LXL04_031270
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 94.495 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031270

Location Chr07:3713823-3714423 (-)

Description Similar to MTB1: Transcription factor MTB1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01260`	Transcription factor bHLH13.	No verified direct reference in this release
`At2g46510`	Transcription activator.	No verified direct reference in this release
`At4g16430`	Transcription factor bHLH3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031270 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0031347 regulation of defense response Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G01260

ath:AT2G46510

ath:AT4G16430

sly:101247327

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.718

Rank 1 · LXL04_031270 · OH-1004

Cytoplasm0.301

Rank 2 · LXL04_031270 · OH-1004

Cell membrane0.095

Rank 3 · LXL04_031270 · OH-1004

Endoplasmic reticulum0.063

Rank 4 · LXL04_031270 · OH-1004

Lysosome / Vacuole0.035

Rank 5 · LXL04_031270 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14215.13bHLH-MYC_N52-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031270	`PF14215.13`	bHLH-MYC_N	52	103	4.3e-14	53.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNJ5`	Arabidopsis thaliana	Transcription factor bHLH13	67.368%	Swiss-Prot	strong database homology
`Q9ZPY8`	Arabidopsis thaliana	Transcription factor ABA-INDUCIBLE bHLH-TYPE	53.465%	Swiss-Prot	strong database homology
`O23487`	Arabidopsis thaliana	Transcription factor bHLH3	36.842%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card