LXL04_031268 | RubberDandelionOmics

Gene overview

LXL04_031268

Reference: OH-1004 Chr: Chr07 Coordinates: 3599397-3600247 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

642 bp · LXL04_031268|LXL04_031268|OH1004|cDNA

ATGGCAGCAGCTTTATCATCAATGGCGTCCATGGTCGGGTGGAAACCCATAACCAAAACACCTGAAACCTTAATGCCATCCAGAAAACGCACCAACAATGGCTTCTCAGTGTCGGCGCAACAACAAGAAGTACAGGAATCAACGTCACTACAACAAGAAGAAGTGAAGGAAGAGAAACCGGTGGTGAAGGGTGTGACTCAGCCACGGCCAGTTGAGCCACAAACCAACGTGGAAAGCAAGAACATGGGGCGGGAGTACGG...

CDS

Download CDS FASTA

642 bp · LXL04_031268|LXL04_031268|OH1004|CDS

ATGGCAGCAGCTTTATCATCAATGGCGTCCATGGTCGGGTGGAAACCCATAACCAAAACACCTGAAACCTTAATGCCATCCAGAAAACGCACCAACAATGGCTTCTCAGTGTCGGCGCAACAACAAGAAGTACAGGAATCAACGTCACTACAACAAGAAGAAGTGAAGGAAGAGAAACCGGTGGTGAAGGGTGTGACTCAGCCACGGCCAGTTGAGCCACAAACCAACGTGGAAAGCAAGAACATGGGGCGGGAGTACGG...

Protein

Download Protein FASTA

213 aa · LXL04_031268|LXL04_031268|OH1004|PROTEIN

MAAALSSMASMVGWKPITKTPETLMPSRKRTNNGFSVSAQQQEVQESTSLQQEEVKEEKPVVKGVTQPRPVEPQTNVESKNMGREYGGQWLSSTTRHVRIFAAYIDPETFAFDQTQMDKLTLILDPTDEFVWTPETCTMVYSYFQELVDHYEGAPLTEYTLRLIGSDIEHYIRKLLYEGQIQYNMNARVLNFSMGKPRIGFNYNEYQIEDVNK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031268`
TK1151 ID	TkA08G098210
OH-1004 ID	LXL04_031268
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.800
Protein coverage (%)	TK1151 66.935 / OH-1004 38.967 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031268

Location Chr07:3599397-3600247 (+)

Description Similar to ndhM: NAD(P)H-quinone oxidoreductase subunit M, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37925`	NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0539000`	NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain.	No verified direct reference in this release
`UniProt: A2XVZ1`	NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031268 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010258 NADH dehydrogenase complex (plastoquinone) assembly Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0010598 NAD(P)H dehydrogenase complex (plastoquinone) Cellular Component

GO:0016655 oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor Molecular Function

GO:0048038 quinone binding Molecular Function

KEGG gene cross-reference

ath:AT4G37925

dosa:Os04g0539000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.977

Rank 1 · LXL04_031268 · OH-1004

Mitochondrion0.026

Rank 2 · LXL04_031268 · OH-1004

Nucleus0.024

Rank 3 · LXL04_031268 · OH-1004

Cytoplasm0.016

Rank 4 · LXL04_031268 · OH-1004

Cell membrane0.012

Rank 5 · LXL04_031268 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10664.16NdhM40-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031268	`PF10664.16`	NdhM	40	199	1.1e-86	289.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2V2S7`	Arabidopsis thaliana	NAD(P)H-quinone oxidoreductase subunit M, chloroplastic	67.978%	Swiss-Prot	strong database homology
`Q7FB12`	Oryza sativa subsp. japonica	NAD(P)H-quinone oxidoreductase subunit M, chloroplastic	71.429%	Swiss-Prot	strong database homology
`A2XVZ1`	Oryza sativa subsp. indica	NAD(P)H-quinone oxidoreductase subunit M, chloroplastic	71.429%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card