LXL04_031252 | RubberDandelionOmics

Gene overview

LXL04_031252

Reference: OH-1004 Chr: Chr07 Coordinates: 3257987-3260864 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1101 bp · LXL04_031252|LXL04_031252|OH1004|cDNA

ATGATGCGCCATAACATGAACCAGCCTGACAACTCAAATATGACTTCCGGCAAGGACAACTGCGTCGGGTGGGCAGCAAGGGATCCATCTGGATTTCTATCGCCATACGAATTTAATCGCAGGGATGTTGGAGCTGATGATGTTTCACTAACAATCCTTTACTGTGGAGTCTGTTATGCGGATGTTGCATGGACTAGGAATGTACAAGGACACTCCAAGTATCCTCTGGTACCTGGTCATGAGATTGTTGGAATTGTGAA...

CDS

Download CDS FASTA

1101 bp · LXL04_031252|LXL04_031252|OH1004|CDS

ATGATGCGCCATAACATGAACCAGCCTGACAACTCAAATATGACTTCCGGCAAGGACAACTGCGTCGGGTGGGCAGCAAGGGATCCATCTGGATTTCTATCGCCATACGAATTTAATCGCAGGGATGTTGGAGCTGATGATGTTTCACTAACAATCCTTTACTGTGGAGTCTGTTATGCGGATGTTGCATGGACTAGGAATGTACAAGGACACTCCAAGTATCCTCTGGTACCTGGTCATGAGATTGTTGGAATTGTGAA...

Protein

Download Protein FASTA

366 aa · LXL04_031252|LXL04_031252|OH1004|PROTEIN

MMRHNMNQPDNSNMTSGKDNCVGWAARDPSGFLSPYEFNRRDVGADDVSLTILYCGVCYADVAWTRNVQGHSKYPLVPGHEIVGIVKEVGSNVEGVKPGDHVGVGTYVNSCRECEYCDEGLEVQCVKGAVLTFDGIDTDGTVTKGGCSSYYVVHQRYCFKIPENYPLASAAPLLCAGITVWTPMMHHNMNQPGKSLGVIGLGGLGHMAVKFGKSFGLRVSVFSTSLSKKDEALNVLGADNFILSSNDEEMKAMEKSLDFV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031252`
TK1151 ID	TkA08G097040
OH-1004 ID	LXL04_031252
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 99.717 / OH-1004 96.175 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031252

Location Chr07:3257987-3260864 (-)

Description Similar to CAD1: Probable cinnamyl alcohol dehydrogenase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72680`	Involved in lignin biosynthesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0194200`	Involved in lignin biosynthesis.	No verified direct reference in this release
`Os11g0622800`	Involved in lignin biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031252 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009809 lignin biosynthetic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function

GO:0045551 cinnamyl-alcohol dehydrogenase activity Molecular Function

GO:0050268 coniferyl-alcohol dehydrogenase activity Molecular Function

KEGG gene cross-reference

ath:AT1G72680

dosa:Os10g0194200

dosa:Os11g0622800

osa:4348242

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.729

Rank 1 · LXL04_031252 · OH-1004

Nucleus0.292

Rank 2 · LXL04_031252 · OH-1004

Mitochondrion0.074

Rank 3 · LXL04_031252 · OH-1004

Peroxisome0.062

Rank 4 · LXL04_031252 · OH-1004

Cell membrane0.062

Rank 5 · LXL04_031252 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08240.18ADH_N44-163 aa

PF00107.33ADH_zinc_N203-323 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031252	`PF08240.18`	ADH_N	44	163	3.6e-23	82.5
LXL04_031252	`PF00107.33`	ADH_zinc_N	203	323	1.9e-18	67.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAI3`	Arabidopsis thaliana	Probable cinnamyl alcohol dehydrogenase 1	71.186%	Swiss-Prot	strong database homology
`Q8H859`	Oryza sativa subsp. japonica	Probable cinnamyl alcohol dehydrogenase 1	67.622%	Swiss-Prot	strong database homology
`Q2R114`	Oryza sativa subsp. japonica	Putative cinnamyl alcohol dehydrogenase 4	66.476%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card