LXL04_031245 | RubberDandelionOmics

Gene overview

LXL04_031245

Reference: OH-1004 Chr: Chr07 Coordinates: 3088393-3089819 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

931 bp · LXL04_031245|LXL04_031245|OH1004|cDNA

CGATATCCAAATTTCATCCACCATTCACCATCTTCAACCCCTTCCTTCCCCCCAACCAATTCCTCACAGACCCATTTTCCTGAATTGCAACAAAATTTTGAAATTCCCCCCTCTTCATCTCTGTTTTATTCGCCGTCTCTTGTTGGTGCTTCGGTGGGGGTCCAAAATCGAGCCCCACATGCAACCAGACCCAGCACCGACATCATCACAGAATGAACAACCGTCGACGTCgccaccgccgccaccaccaccggcgGTGA...

CDS

Download CDS FASTA

852 bp · LXL04_031245|LXL04_031245|OH1004|CDS

CTGAATTGCAACAAAATTTTGAAATTCCCCCCTCTTCATCTCTGTTTTATTCGCCGTCTCTTGTTGGTGCTTCGGTGGGGGTCCAAAATCGAGCCCCACATGCAACCAGACCCAGCACCGACATCATCACAGAATGAACAACCGTCGACGTCGCCACCGCCGCCACCACCACCGGCGGTGATTCCGCAATCAGCACCACAATGGCAACAATCAACGATGGTTGCGCCACCGCCTCTGCACTACCAAACGTACAACCCTCC...

Protein

Download Protein FASTA

283 aa · LXL04_031245|LXL04_031245|OH1004|PROTEIN

MNCNKILKFPPLHLCFIRRLLLVLRWGSKIEPHMQPDPAPTSSQNEQPSTSPPPPPPPAVIPQSAPQWQQSTMVAPPPLHYQTYNPPMIPTQNPPGTTAVPPHFYHLQPGAASSGARYPYSLSPRRSAPGHLYPDHERDWSTGLFQCTSNMKNCFVTTICPCITFGEIAEILTEGHTPWYEPATLCACLGAASFVFIFMLWLTFPYTCLYRIKMRKKYKLKGSLIEDCLINAFCGWCALCQQYRELDHQGFNVSIGWHEN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031245`
TK1151 ID	TkA08G096740
OH-1004 ID	LXL04_031245
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	43.400
Protein coverage (%)	TK1151 88.477 / OH-1004 76.678 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031245

Location Chr07:3088393-3089819 (+)

Description Similar to PCR2: Protein PLANT CADMIUM RESISTANCE 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14870`	Zinc transporter acting in both zinc extrusion and long-distance zinc transport.	Arabidopsis PCR2 is a zinc exporter involved in both zinc extrusion and long-distance zinc transport.2010 · DOI: 10.1105/tpc.109.070185
`At5g35525`	May be involved in heavy metals transport.	No verified direct reference in this release
`At1g14880`	Involved in glutathione-independent cadmium resistance.	A novel family of cys-rich membrane proteins mediates cadmium resistance in Arabidopsis.2004 · DOI: 10.1104/pp.103.037739
`At3g18460`	May be involved in heavy metals transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031245 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G14870

ath:AT1G14880

ath:AT3G18460

ath:AT5G35525

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.551

Rank 1 · LXL04_031245 · OH-1004

Cytoplasm0.185

Rank 2 · LXL04_031245 · OH-1004

Endoplasmic reticulum0.167

Rank 3 · LXL04_031245 · OH-1004

Lysosome / Vacuole0.115

Rank 4 · LXL04_031245 · OH-1004

Nucleus0.112

Rank 5 · LXL04_031245 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04749.23PLAC8140-245 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031245	`PF04749.23`	PLAC8	140	245	2.5e-28	99.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LQU4`	Arabidopsis thaliana	Protein PLANT CADMIUM RESISTANCE 2	39.216%	Swiss-Prot	moderate database homology
`P0CW97`	Arabidopsis thaliana	Protein PLANT CADMIUM RESISTANCE 3	36.601%	Swiss-Prot	moderate database homology
`Q9LQU2`	Arabidopsis thaliana	Protein PLANT CADMIUM RESISTANCE 1	37.255%	Swiss-Prot	moderate database homology
`Q9LS44`	Arabidopsis thaliana	Protein PLANT CADMIUM RESISTANCE 4	40.141%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card