LXL04_031209 | RubberDandelionOmics

Gene overview

LXL04_031209

Reference: OH-1004 Chr: Chr07 Coordinates: 2523013-2524631 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

555 bp · LXL04_031209|LXL04_031209|OH1004|cDNA

ATGTATGCCTCATTGATCACTTCCCATGAATCAACAAGCAATCCTGCTTCCCAAATTGGAAACCAtacttcatcatcttcttcttctaaCTACAATTTTGATATTCCTGGTGGGAATGATCAAATATATAACTTTGATTTTGACGACGATCTTCTGGCGATGGTCACTTCTCCAAATTACCAAGATCTTGGCTTTTCAAAATTTACAGGATCTTTTCACAATGAGTGGACACCAATACTCGAAGAAATGGCCATACCCAC...

CDS

Download CDS FASTA

555 bp · LXL04_031209|LXL04_031209|OH1004|CDS

ATGTATGCCTCATTGATCACTTCCCATGAATCAACAAGCAATCCTGCTTCCCAAATTGGAAACCATACTTCATCATCTTCTTCTTCTAACTACAATTTTGATATTCCTGGTGGGAATGATCAAATATATAACTTTGATTTTGACGACGATCTTCTGGCGATGGTCACTTCTCCAAATTACCAAGATCTTGGCTTTTCAAAATTTACAGGATCTTTTCACAATGAGTGGACACCAATACTCGAAGAAATGGCCATACCCAC...

Protein

Download Protein FASTA

184 aa · LXL04_031209|LXL04_031209|OH1004|PROTEIN

MYASLITSHESTSNPASQIGNHTSSSSSSNYNFDIPGGNDQIYNFDFDDDLLAMVTSPNYQDLGFSKFTGSFHNEWTPILEEMAIPTMDPICSYGSISSTNIPPPKKGKRMHCESWVALRMKTDRENLDDGYRWRKYGKKKVKSSPNPRNYYKCWVIGCNVKKRVERDRDDSSETNLDTSTGDV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031209`
TK1151 ID	TkA08G094820
OH-1004 ID	LXL04_031209
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031209

Location Chr07:2523013-2524631 (-)

Description Similar to WRKY50: Probable WRKY transcription factor 50

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26170`	Transcription factor.	No verified direct reference in this release
`At5g49520`	Transcription factor.	No verified direct reference in this release
`At1g69310`	Transcription factor.	No verified direct reference in this release
`At2g47260`	Transcription factor.	No verified direct reference in this release
`At5g64810`	Transcription factor.	Low oleic acid-derived repression of jasmonic acid-inducible defense responses requires the WRKY50 and WRKY51 proteins.2011 · DOI: 10.1104/pp.110.166876

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031209 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009624 response to nematode Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050832 defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT1G69310

ath:AT2G47260

ath:AT5G26170

ath:AT5G49520

ath:AT5G64810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.957

Rank 1 · LXL04_031209 · OH-1004

Cytoplasm0.147

Rank 2 · LXL04_031209 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_031209 · OH-1004

Endoplasmic reticulum0.015

Rank 4 · LXL04_031209 · OH-1004

Mitochondrion0.012

Rank 5 · LXL04_031209 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03106.22WRKY129-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031209	`PF03106.22`	WRKY	129	174	7.1e-18	65.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VWQ5`	Arabidopsis thaliana	Probable WRKY transcription factor 50	70.175%	Swiss-Prot	weak database homology
`Q9FGZ4`	Arabidopsis thaliana	Probable WRKY transcription factor 48	63.333%	Swiss-Prot	weak database homology
`Q9C983`	Arabidopsis thaliana	Probable WRKY transcription factor 57	48.235%	Swiss-Prot	weak database homology
`O22900`	Arabidopsis thaliana	WRKY transcription factor 23	52.941%	Swiss-Prot	weak database homology
`Q93WU9`	Arabidopsis thaliana	Probable WRKY transcription factor 51	43.243%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card