LXL04_031201 | RubberDandelionOmics

Gene overview

LXL04_031201

Reference: OH-1004 Chr: Chr07 Coordinates: 2400198-2401524 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

861 bp · LXL04_031201|LXL04_031201|OH1004|cDNA

ATGTTTAATAGGGCTATTGGATTTGCACCAAATGGGACCTACTGGCGGCTCTTGAGAAAAGTCGCTTCATCTCATCTCTTTGCTCCCAGGAAAATCTCCGCTCACGAACCTGCACGTGACCTCGAATGCACCTCCATGTTGAATGACATTCGTAAGGAACAATCGTTGCATGGATTTGTTGTACTAAGAAAGCACTTGCAAGATGCTTCTTTGAACAACATAATGGAAATTGTTTTTGGGAAAAGCTACAATaaagttgg...

CDS

Download CDS FASTA

861 bp · LXL04_031201|LXL04_031201|OH1004|CDS

ATGTTTAATAGGGCTATTGGATTTGCACCAAATGGGACCTACTGGCGGCTCTTGAGAAAAGTCGCTTCATCTCATCTCTTTGCTCCCAGGAAAATCTCCGCTCACGAACCTGCACGTGACCTCGAATGCACCTCCATGTTGAATGACATTCGTAAGGAACAATCGTTGCATGGATTTGTTGTACTAAGAAAGCACTTGCAAGATGCTTCTTTGAACAACATAATGGAAATTGTTTTTGGGAAAAGCTACAATAAAGTTGG...

Protein

Download Protein FASTA

286 aa · LXL04_031201|LXL04_031201|OH1004|PROTEIN

MFNRAIGFAPNGTYWRLLRKVASSHLFAPRKISAHEPARDLECTSMLNDIRKEQSLHGFVVLRKHLQDASLNNIMEIVFGKSYNKVGDDVDESMELQEMVREGFELLGAFNWCDHLPWLNYFYDPFRIKERCMVLVPKVKKFVKKIINEHKLRGSVNLHDRSDFVDVLLSLDGQDNLSEEDMVAVLWRVIIFYENVFRDPERFIVSAGGSSVDIRGNDLRLAPLGAGRRVCPGMNLGMVTVSEWVAKLVHQFEWVQDMGR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031201`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031201

Location Chr07:2400198-2401524 (+)

Description Similar to CYP78A7: Cytochrome P450 78A7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g09970`	Functions probably in association with CYP78A5 in regulating relative growth of the shoot apical meristem and plant organs via a non-cell-autonomous signal.	Dual effects of miR156-targeted SPL genes and CYP78A5/KLUH on plastochron length and organ size in Arabidopsis thaliana.2008 · DOI: 10.1105/tpc.108.058180
`At3g61880`	Plays a role in seed and fruit development.	Overexpression of a gene encoding a cytochrome P450, CYP78A9, induces large and seedless fruit in arabidopsis.2000 · DOI: 10.1105/tpc.12.9.1541 Maternal control of seed size by EOD3/CYP78A6 in Arabidopsis thaliana.2012 · DOI: 10.1111/j.1365-313x.2012.04907.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0403000`	Involved in the regular timing (plastochron) of lateral organs formation.	PLASTOCHRON1, a timekeeper of leaf initiation in rice, encodes cytochrome P450.2004 · DOI: 10.1073/pnas.2636936100

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031201 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009791 post-embryonic development Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0048731 system development Biological Process

GO:0090709 regulation of timing of plant organ formation Biological Process

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0020037 heme binding Molecular Function

KEGG gene cross-reference

ag:AAA61607

ath:AT5G09970

dosa:Os10g0403000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.910

Rank 1 · LXL04_031201 · OH-1004

Plastid0.043

Rank 2 · LXL04_031201 · OH-1004

Cytoplasm0.037

Rank 3 · LXL04_031201 · OH-1004

Cell membrane0.033

Rank 4 · LXL04_031201 · OH-1004

Nucleus0.025

Rank 5 · LXL04_031201 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p4508-188 aa

PF00067.28p450199-260 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031201	`PF00067.28`	p450	8	188	2.3e-26	93.3
LXL04_031201	`PF00067.28`	p450	199	260	2.3e-26	93.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIB0`	Arabidopsis thaliana	Cytochrome P450 78A7	60.417%	Swiss-Prot	moderate database homology
`Q9SLP1`	Arabidopsis thaliana	Cytochrome P450 78A9	50.526%	Swiss-Prot	moderate database homology
`Q7Y1V5`	Oryza sativa subsp. japonica	Cytochrome P450 78A11	57.143%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card