LXL04_031185 | RubberDandelionOmics

Gene overview

LXL04_031185

Reference: OH-1004 Chr: Chr07 Coordinates: 1966660-1967586 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

834 bp · LXL04_031185|LXL04_031185|OH1004|cDNA

ATGGCGACTAGTTTGGTACGTAGAGGTATTTCCAGGCTTCAAACGTCTCCGGCGGCGACACTTTTGCTTTCCCGAGCTCATGCTTCCGGGCCTCAAGCTCAACAATCGGAATCCGCCGCCAGTTCTTCACAAAATCTAAAGAATTTCCAAATCTACCGATGGAATCCGGACAATCCAGCCAAACCGGAGCTACGAAACTACCAGATAAACCTTAAGGAGTGTGGACCGATGGTACTCGATGCACTTATTAAGATCAAGAA...

CDS

Download CDS FASTA

834 bp · LXL04_031185|LXL04_031185|OH1004|CDS

ATGGCGACTAGTTTGGTACGTAGAGGTATTTCCAGGCTTCAAACGTCTCCGGCGGCGACACTTTTGCTTTCCCGAGCTCATGCTTCCGGGCCTCAAGCTCAACAATCGGAATCCGCCGCCAGTTCTTCACAAAATCTAAAGAATTTCCAAATCTACCGATGGAATCCGGACAATCCAGCCAAACCGGAGCTACGAAACTACCAGATAAACCTTAAGGAGTGTGGACCGATGGTACTCGATGCACTTATTAAGATCAAGAA...

Protein

Download Protein FASTA

277 aa · LXL04_031185|LXL04_031185|OH1004|PROTEIN

MATSLVRRGISRLQTSPAATLLLSRAHASGPQAQQSESAASSSQNLKNFQIYRWNPDNPAKPELRNYQINLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKIPSEETTMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPAPSGWEGKEIPQSKKDRQKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWIMDSRDEYTQERLDAVNDEFKLYRCHTILNCARACP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031185`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031185

Location Chr07:1966660-1967586 (+)

Description Similar to SDH2-2: Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40650`	Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).	No verified direct reference in this release
`At3g27380`	Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0120000`	Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031185 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0006121 mitochondrial electron transport, succinate to ubiquinone Biological Process

GO:0009060 aerobic respiration Biological Process

GO:0022904 respiratory electron transport chain Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0045273 respiratory chain complex II (succinate dehydrogenase) Cellular Component

GO:0000104 succinate dehydrogenase activity Molecular Function

GO:0008177 succinate dehydrogenase (quinone) activity Molecular Function

KEGG gene cross-reference

ath:AT3G27380

ath:AT5G40650

dme:Dmel_CG3283

dosa:Os08g0120000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.958

Rank 1 · LXL04_031185 · OH-1004

Cytoplasm0.053

Rank 2 · LXL04_031185 · OH-1004

Nucleus0.052

Rank 3 · LXL04_031185 · OH-1004

Cell membrane0.029

Rank 4 · LXL04_031185 · OH-1004

Plastid0.014

Rank 5 · LXL04_031185 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13085.12Fer2_348-151 aa

PF13183.12Fer4_8189-263 aa

PF13534.12Fer4_17191-264 aa

PF13237.12Fer4_10191-260 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031185	`PF13085.12`	Fer2_3	48	151	5.8e-33	113.8
LXL04_031185	`PF13183.12`	Fer4_8	189	263	7.9e-09	36.7
LXL04_031185	`PF13534.12`	Fer4_17	191	264	2.8e-09	38.1
LXL04_031185	`PF13237.12`	Fer4_10	191	260	1.7e-07	31.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LB02`	Arabidopsis thaliana	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial	76.703%	Swiss-Prot	strong database homology
`Q8LBZ7`	Arabidopsis thaliana	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial	76.429%	Swiss-Prot	strong database homology
`Q9S827`	Oryza sativa subsp. japonica	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial	67.626%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card