LXL04_031183 | RubberDandelionOmics

Gene overview

LXL04_031183

Reference: OH-1004 Chr: Chr07 Coordinates: 1958682-1962123 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1359 bp · LXL04_031183|LXL04_031183|OH1004|cDNA

ATGTTGGAGAGGAGAAGAATGAGGAAAAATGTGGAGACAGGAAGAAATGAGGGTAAGTTAGAGATGATCTTAGACAAAGAATTCAAGAGACATGCTAAAGGGAATGATGATTGTAAATCACGAATTAGAACCACCCTTTCCAACAATTCTCTAGTTTCTGCCAaccaaaccaaaatcaaaaccaaaCTCCATCATATAATCTCTCCAAATCAACCTCAAGTCTCTAGCTATCTGTTGATCGTCTTCTTCTCCGCCAACTT...

CDS

Download CDS FASTA

1359 bp · LXL04_031183|LXL04_031183|OH1004|CDS

ATGTTGGAGAGGAGAAGAATGAGGAAAAATGTGGAGACAGGAAGAAATGAGGGTAAGTTAGAGATGATCTTAGACAAAGAATTCAAGAGACATGCTAAAGGGAATGATGATTGTAAATCACGAATTAGAACCACCCTTTCCAACAATTCTCTAGTTTCTGCCAACCAAACCAAAATCAAAACCAAACTCCATCATATAATCTCTCCAAATCAACCTCAAGTCTCTAGCTATCTGTTGATCGTCTTCTTCTCCGCCAACTT...

Protein

Download Protein FASTA

452 aa · LXL04_031183|LXL04_031183|OH1004|PROTEIN

MLERRRMRKNVETGRNEGKLEMILDKEFKRHAKGNDDCKSRIRTTLSNNSLVSANQTKIKTKLHHIISPNQPQVSSYLLIVFFSANFLLVLATNTLSASIVSPNPQIIHFLLLFQMAATTFHQAIGTLEPRGHIGNFTFHQECGSTPMRLTAKSLKVKIGPLKSCRSIQSSSSSSSSYHTSEYNPSNDTNYNSPKKPSEAALILIRHGESLWNEKNLFTGCVDVPLTKKGVEEAIEAGKRISNIPIDMIYTSSLIRAQMT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031183`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031183

Location Chr07:1958682-1962123 (-)

Description Similar to gpmA: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (Protochlamydia amoebophila (strain UWE25)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22170`	Catalyzes the interconversion of 2-phosphoglycerate and 3-phosphoglycerate.	No verified direct reference in this release
`At1g78050`	Catalyzes the interconversion of 2-phosphoglycerate and 3-phosphoglycerate.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031183 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006094 gluconeogenesis Biological Process

GO:0006096 glycolytic process Biological Process

GO:0010167 response to nitrate Biological Process

GO:0061621 canonical glycolysis Biological Process

GO:0080033 response to nitrite Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0004619 phosphoglycerate mutase activity Molecular Function

KEGG gene cross-reference

ath:AT1G22170

ath:AT1G78050

cfe:CF0110

cmu:TC_0095

pcu:PC_RS00790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.916

Rank 1 · LXL04_031183 · OH-1004

Mitochondrion0.072

Rank 2 · LXL04_031183 · OH-1004

Cytoplasm0.061

Rank 3 · LXL04_031183 · OH-1004

Nucleus0.051

Rank 4 · LXL04_031183 · OH-1004

Peroxisome0.027

Rank 5 · LXL04_031183 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00300.28His_Phos_1202-275 aa

PF00300.28His_Phos_1290-404 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031183	`PF00300.28`	His_Phos_1	202	275	1.4e-36	126.7
LXL04_031183	`PF00300.28`	His_Phos_1	290	404	1.4e-36	126.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LM13`	Arabidopsis thaliana	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1	70.448%	Swiss-Prot	strong database homology
`F4I8M8`	Arabidopsis thaliana	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2	65.373%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card