Gene Card
Gene overview
cDNA / CDS / Protein Sequences
742 bp · LXL04_031160|LXL04_031160|OH1004|cDNA
ATGAAGTTTAACATTGCCAATCCTACCACCGGGTGCCAGAAGAAACTCGAGATTGATGATGATCAAAAACTCCGTGCATTTTACGATAAGAGGATCTCACAGGAAGTTAACGGAGATGCTCTTGGGGAGGAATTCAAAGGCTATGTTTTCAAAATCATGGGCGGATGTGACAAGCAAGGATTTCCAATGAAACAGGGAGTTCTAACTCCTGGTCGAGTCCGCCTTCTTCTTGTGAGAGGCACACCCTGTTTCCGTGGATA...
732 bp · LXL04_031160|LXL04_031160|OH1004|CDS
ATGAAGTTTAACATTGCCAATCCTACCACCGGGTGCCAGAAGAAACTCGAGATTGATGATGATCAAAAACTCCGTGCATTTTACGATAAGAGGATCTCACAGGAAGTTAACGGAGATGCTCTTGGGGAGGAATTCAAAGGCTATGTTTTCAAAATCATGGGCGGATGTGACAAGCAAGGATTTCCAATGAAACAGGGAGTTCTAACTCCTGGTCGAGTCCGCCTTCTTCTTGTGAGAGGCACACCCTGTTTCCGTGGATA...
Protein
Download Protein FASTA243 aa · LXL04_031160|LXL04_031160|OH1004|PROTEIN
MKFNIANPTTGCQKKLEIDDDQKLRAFYDKRISQEVNGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLVRGTPCFRGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGDNDLPGLTDVEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTNKAGKEVSKAPKIQRLVTPLTLQRKRARIADKKKRIAKAKSEAADYQKLLASRLKEQRDKRSESLAKKRSRLSVAA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_031160 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_031160 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:1439356-1440508 (+) | |||||||||
| Description | Similar to rps6: 40S ribosomal protein S6 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000028 ribosomal small subunit assembly Biological Process GO:0000082 G1/S transition of mitotic cell cycle Biological Process GO:0000278 mitotic cell cycle Biological Process GO:0002181 cytoplasmic translation Biological Process GO:0006364 rRNA processing Biological Process GO:0006412 translation Biological Process GO:0008284 positive regulation of cell population proliferation Biological Process GO:0031929 TOR signaling Biological Process GO:0032868 response to insulin Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0042593 glucose homeostasis Biological Process GO:0071361 cellular response to ethanol Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT4G31700 ath:AT5G10360 rno:29304 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01092.25Ribosomal_S6e1-128 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_031160 | PF01092.25 | Ribosomal_S6e | 1 | 128 | 6.8e-54 | 181.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.