LXL04_031123 | RubberDandelionOmics

Gene overview

LXL04_031123

Reference: OH-1004 Chr: Chr07 Coordinates: 895707-898827 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

981 bp · LXL04_031123|LXL04_031123|OH1004|cDNA

ATGGATCCGAATCAGCCATCTAAACAAACGGCGAAGCCGGAAGATTCTCACTCCACCGACTACGCTCCTTATCCTAAGATTGACCCAACCGACGTGGCTCCTCCGCCGGCTGCGCCTACCGGTGAGAATTGGACCTCAGTTCCTGTTGGTTCTCAACCACAAGCACCGCCGCCGCCTGCTGTTGGACAACCGATGTATACAGCTGCTGCAAGGTCATCGGATGATCCGCCGCAAGGTTCAAACGCTGTACCTGGTGGTGG...

CDS

Download CDS FASTA

981 bp · LXL04_031123|LXL04_031123|OH1004|CDS

ATGGATCCGAATCAGCCATCTAAACAAACGGCGAAGCCGGAAGATTCTCACTCCACCGACTACGCTCCTTATCCTAAGATTGACCCAACCGACGTGGCTCCTCCGCCGGCTGCGCCTACCGGTGAGAATTGGACCTCAGTTCCTGTTGGTTCTCAACCACAAGCACCGCCGCCGCCTGCTGTTGGACAACCGATGTATACAGCTGCTGCAAGGTCATCGGATGATCCGCCGCAAGGTTCAAACGCTGTACCTGGTGGTGG...

Protein

Download Protein FASTA

326 aa · LXL04_031123|LXL04_031123|OH1004|PROTEIN

MDPNQPSKQTAKPEDSHSTDYAPYPKIDPTDVAPPPAAPTGENWTSVPVGSQPQAPPPPAVGQPMYTAAARSSDDPPQGSNAVPGGGATTMPSESNPYVSPGLVPESTTKSECAVVQTMDSVKDVLGKWGKKAAEATKKGQDYAGDVWQHCIAMKLKRMNQKKMIKKKRYYFIASVKTGPSLADAAVGRIAQGTKVIAEGGYEKIFRTTFETVPDEKLLKSYACYLSTSAGPVMGILYMSSAKLAFSSDNPLSYKVGDDT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031123`
TK1151 ID	TkA08G088250
OH-1004 ID	LXL04_031123
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031123

Location Chr07:895707-898827 (-)

Description Similar to FIP1: GEM-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28200`	GEM-like protein 1.	No verified direct reference in this release
`At2g22475`	Involved in the spatial control of cell division, patterning and differentiation of Arabidopsis root epidermal cells.	No verified direct reference in this release
`At4g40100`	Putative GEM-like protein 3.	No verified direct reference in this release
`At5g13200`	GEM-like protein 5.	No verified direct reference in this release
`At4g01600`	GEM-like protein 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031123 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009637 response to blue light Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009845 seed germination Biological Process

GO:0010026 trichome differentiation Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010482 regulation of epidermal cell division Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0048765 root hair cell differentiation Biological Process

GO:0098755 maintenance of seed dormancy by absisic acid Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G28200

ath:AT2G22475

ath:AT4G01600

ath:AT4G40100

ath:AT5G13200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.435

Rank 1 · LXL04_031123 · OH-1004

Endoplasmic reticulum0.263

Rank 2 · LXL04_031123 · OH-1004

Cell membrane0.244

Rank 3 · LXL04_031123 · OH-1004

Golgi apparatus0.194

Rank 4 · LXL04_031123 · OH-1004

Nucleus0.176

Rank 5 · LXL04_031123 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02893.27GRAM205-325 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031123	`PF02893.27`	GRAM	205	325	6.3e-22	78.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SE96`	Arabidopsis thaliana	GEM-like protein 1	61.925%	Swiss-Prot	strong database homology
`Q8S8F8`	Arabidopsis thaliana	GLABRA2 expression modulator	61.674%	Swiss-Prot	moderate database homology
`Q9M063`	Arabidopsis thaliana	Putative GEM-like protein 3	51.101%	Swiss-Prot	moderate database homology
`Q9LYV6`	Arabidopsis thaliana	GEM-like protein 5	48.951%	Swiss-Prot	weak database homology
`Q9M122`	Arabidopsis thaliana	GEM-like protein 2	34.513%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card