LXL04_031059 | RubberDandelionOmics

Gene overview

LXL04_031059

Reference: OH-1004 Chr: Chr06 Coordinates: 127348757-127349596 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

840 bp · LXL04_031059|LXL04_031059|OH1004|cDNA

ATGCCCAACGTTCGACCTCCGCCATCACCACCACCAGAACCACCGGaacctccatccgtctactGCACGCCTTCGCCACAATCGAAAACCACCACCCCCTCTCCCATGGCACGTAGTTTCATGTCACGACAACAATCGTCCGTGAAACCATCGCCGATAAGCAAACTCATAGTGTCAAGACAAGCAACGCCACAGCAGAGTTTCGCCTCGGAGTTCCCTTACGAACACATGACATCAAAAGCACACGATAGGCTGTTCCT...

CDS

Download CDS FASTA

840 bp · LXL04_031059|LXL04_031059|OH1004|CDS

ATGCCCAACGTTCGACCTCCGCCATCACCACCACCAGAACCACCGGAACCTCCATCCGTCTACTGCACGCCTTCGCCACAATCGAAAACCACCACCCCCTCTCCCATGGCACGTAGTTTCATGTCACGACAACAATCGTCCGTGAAACCATCGCCGATAAGCAAACTCATAGTGTCAAGACAAGCAACGCCACAGCAGAGTTTCGCCTCGGAGTTCCCTTACGAACACATGACATCAAAAGCACACGATAGGCTGTTCCT...

Protein

Download Protein FASTA

279 aa · LXL04_031059|LXL04_031059|OH1004|PROTEIN

MPNVRPPPSPPPEPPEPPSVYCTPSPQSKTTTPSPMARSFMSRQQSSVKPSPISKLIVSRQATPQQSFASEFPYEHMTSKAHDRLFLGRHRHTNPAIWCSAIICLIFSLLVIFFGIATLIIFLVVKPKTPVLDTNHANLSVIYFDAPGNFNGDFTFMANFSNPNRKLGVKFEQAVMELLFEDSLIATQSIRPFSQRPKETGVVPINFISSLVSLPANNAMELRRQVLSNKVMYSVRGTFKVRASLGSIHYSYWLHGLCEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031059`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031059

Location Chr06:127348757-127349596 (-)

Description Similar to NHL3: NDR1/HIN1-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06320`	Confers resistance to Pseudomonas syringae pv. tomato DC3000 (Pst DC3000).	The Arabidopsis NHL3 gene encodes a plasma membrane protein and its overexpression correlates with increased resistance to Pseudomonas syringae pv. tomato DC3000.2003 · DOI: 10.1104/pp.103.020438
`At3g11650`	May play a role in plant immunity.	No verified direct reference in this release
`At2g35980`	May play a role in plant immunity.	No verified direct reference in this release
`At2g27080`	Required for plant immunity against the bacterial pathogen Pseudomonas syringae pv. tomato DC3000 (Pst DC3000).	Pseudomonas syringae Effector Avirulence Protein E Localizes to the Host Plasma Membrane and Down-Regulates the Expression of the NONRACE-SPECIFIC DISEASE RESISTANCE1/HARPIN-INDUCED1-LIKE13 Gene Required for Antibacterial Immunity in Arabidopsis.2015 · DOI: 10.1104/pp.15.00547

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031059 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0010150 leaf senescence Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0051607 defense response to virus Biological Process

GO:0051707 response to other organism Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT2G27080

ath:AT2G35980

ath:AT3G11650

ath:AT5G06320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.589

Rank 1 · LXL04_031059 · OH-1004

Lysosome / Vacuole0.155

Rank 2 · LXL04_031059 · OH-1004

Cytoplasm0.139

Rank 3 · LXL04_031059 · OH-1004

Endoplasmic reticulum0.138

Rank 4 · LXL04_031059 · OH-1004

Golgi apparatus0.077

Rank 5 · LXL04_031059 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNH6`	Arabidopsis thaliana	NDR1/HIN1-like protein 3	26.316%	Swiss-Prot	weak database homology
`Q9SRN1`	Arabidopsis thaliana	NDR1/HIN1-like protein 2	21.935%	Swiss-Prot	weak database homology
`Q9SJ52`	Arabidopsis thaliana	NDR1/HIN1-like protein 10	25.301%	Swiss-Prot	weak database homology
`Q9ZVD2`	Arabidopsis thaliana	NDR1/HIN1-like protein 13	20.765%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card