LXL04_031056 | RubberDandelionOmics

Gene overview

LXL04_031056

Reference: OH-1004 Chr: Chr06 Coordinates: 127327199-127328342 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

612 bp · LXL04_031056|LXL04_031056|OH1004|cDNA

ATGGCAGAGGCCGATTCGGTGGTGGACGAGGCTGCGGTGGTGACCGTTTCGGTGGTGACAGGTTTAACGAAAGACCTCCTGACCAAGTTATTTTATCACAACCATCTTGATTTTGAATCTCGATGTATTGCTAATTTTGCTGAGGTTTCCGCATTGGTTCACGCCTGTGAAGGAGAGGCAGTGACAAAGCTCACAAATGAGAAAATACCTTACTTCAATGCCTCCATTTACCTTCAAAATAAAACTCAAATAGGCAAAGT...

CDS

Download CDS FASTA

612 bp · LXL04_031056|LXL04_031056|OH1004|CDS

ATGGCAGAGGCCGATTCGGTGGTGGACGAGGCTGCGGTGGTGACCGTTTCGGTGGTGACAGGTTTAACGAAAGACCTCCTGACCAAGTTATTTTATCACAACCATCTTGATTTTGAATCTCGATGTATTGCTAATTTTGCTGAGGTTTCCGCATTGGTTCACGCCTGTGAAGGAGAGGCAGTGACAAAGCTCACAAATGAGAAAATACCTTACTTCAATGCCTCCATTTACCTTCAAAATAAAACTCAAATAGGCAAAGT...

Protein

Download Protein FASTA

203 aa · LXL04_031056|LXL04_031056|OH1004|PROTEIN

MAEADSVVDEAAVVTVSVVTGLTKDLLTKLFYHNHLDFESRCIANFAEVSALVHACEGEAVTKLTNEKIPYFNASIYLQNKTQIGKVDEIFGPINESGGKVLKEMDALHGSPLEAGPTTHLPEKNLLFILDRLQNREETRAVLSEPIDPFENNLRSLALLGANSTRFFNLILKNWRLASSIQELAKRDFDNSGLYTSISKKGF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031056`
TK1151 ID	TkA07G137080
OH-1004 ID	LXL04_031056
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	61.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031056

Location Chr06:127327199-127328342 (-)

Description Similar to At3g03920: Putative H/ACA ribonucleoprotein complex subunit 1-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03920`	Required for ribosome biogenesis.	No verified direct reference in this release
`At5g18180`	Required for ribosome biogenesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031056 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000454 snoRNA guided rRNA pseudouridine synthesis Biological Process

GO:0031120 snRNA pseudouridine synthesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0031429 box H/ACA snoRNP complex Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0034513 box H/ACA snoRNA binding Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT3G03920

ath:AT5G18180

kla:KLLA0_F21604g

sce:YHR089C

spo:2540705

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.513

Rank 1 · LXL04_031056 · OH-1004

Nucleus0.377

Rank 2 · LXL04_031056 · OH-1004

Mitochondrion0.120

Rank 3 · LXL04_031056 · OH-1004

Endoplasmic reticulum0.072

Rank 4 · LXL04_031056 · OH-1004

Cell membrane0.068

Rank 5 · LXL04_031056 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04410.21Gar148-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031056	`PF04410.21`	Gar1	48	96	1.8e-15	57.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZT0`	Arabidopsis thaliana	Putative H/ACA ribonucleoprotein complex subunit 1-like protein 1	82.000%	Swiss-Prot	weak database homology
`Q9FK53`	Arabidopsis thaliana	H/ACA ribonucleoprotein complex subunit 1-like protein 2	78.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card