LXL04_031002 | RubberDandelionOmics

Gene overview

LXL04_031002

Reference: OH-1004 Chr: Chr06 Coordinates: 126585929-126596143 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1224 bp · LXL04_031002|LXL04_031002|OH1004|cDNA

ATGGTGGGGGGTTTGAGAGCAAAACGAAAGATAAAAAGGAGCGAGGGTGAAGACGGTTTACGCCTTAGGGGGGAGTCGTGGGATCCTGATGCTGGTATATCGGCGAATAGTTGTAGAAGGGGCGAGAAGAGAGGAAGGGCCATCCCCGACATTTTAGAGGCCCTGTACAATTTAGAAAAGGACCGAGCATCCATGAAAAGGATAACGATGAAGGGCATGAAGTCACTGAAGCAGCTCAAGCTCTCTGTTCCTACTCAAGA...

CDS

Download CDS FASTA

1224 bp · LXL04_031002|LXL04_031002|OH1004|CDS

ATGGTGGGGGGTTTGAGAGCAAAACGAAAGATAAAAAGGAGCGAGGGTGAAGACGGTTTACGCCTTAGGGGGGAGTCGTGGGATCCTGATGCTGGTATATCGGCGAATAGTTGTAGAAGGGGCGAGAAGAGAGGAAGGGCCATCCCCGACATTTTAGAGGCCCTGTACAATTTAGAAAAGGACCGAGCATCCATGAAAAGGATAACGATGAAGGGCATGAAGTCACTGAAGCAGCTCAAGCTCTCTGTTCCTACTCAAGA...

Protein

Download Protein FASTA

407 aa · LXL04_031002|LXL04_031002|OH1004|PROTEIN

MVGGLRAKRKIKRSEGEDGLRLRGESWDPDAGISANSCRRGEKRGRAIPDILEALYNLEKDRASMKRITMKGMKSLKQLKLSVPTQDASITSFLTTSGTFHDGYLLLNLKGLRLASEDKENRPSDAKEIDLQFSLEDLETISQLVRYKWIGRLFALKVIQMNKQEDIRKQIVQELKINQASQCPNIVVCYHSFYHNGAISLVFEYMDRGSLTDVIRQLKTILEPYLVVLCKQVLQGLVYLHHERHVIHGDIKPSNLLVNQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031002`
TK1151 ID	TkA07G444710
OH-1004 ID	LXL04_031002
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 60.688 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031002

Location Chr06:126585929-126596143 (+)

Description Similar to MKK6: Mitogen-activated protein kinase kinase 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56580`	The ANPs-MKK6-MPK4 module is involved in the regulation of plant cytokinesis during meiosis and mitosis.	NQK1/NtMEK1 is a MAPKK that acts in the NPK1 MAPKKK-mediated MAPK cascade and is required for plant cytokinesis.2003 · DOI: 10.1101/gad.1071103 The Arabidopsis thaliana MEK AtMKK6 activates the MAP kinase AtMPK13.2004 · DOI: 10.1016/j.febslet.2004.08.051 HINKEL kinesin, ANP MAPKKKs and MKK6/ANQ MAPKK, which phosphorylates and activates MPK4 MAPK, constitute a pathway that is required for cytokinesis in Arabidopsis thaliana.2010 · DOI: 10.1093/pcp/pcq135 The MAP kinase MPK4 is required for cytokinesis in Arabidopsis thaliana.2010 · DOI: 10.1105/tpc.110.077164 AtMPK4 is required for male-specific meiotic cytokinesis in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04642.x AtMKK6 and AtMPK13 are required for lateral root formation in Arabidopsis.2011 · DOI: 10.4161/psb.6.10.17089

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0510100`	Mitogen-activated protein kinase kinase 1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031002 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006952 defense response Biological Process

GO:0007112 male meiosis cytokinesis Biological Process

GO:0007165 signal transduction Biological Process

GO:0010200 response to chitin Biological Process

GO:0010311 lateral root formation Biological Process

GO:0051707 response to other organism Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004708 MAP kinase kinase activity Molecular Function

GO:0004713 protein tyrosine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G56580

dosa:Os01g0510100

nta:107818847

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.575

Rank 1 · LXL04_031002 · OH-1004

Nucleus0.354

Rank 2 · LXL04_031002 · OH-1004

Cell membrane0.114

Rank 3 · LXL04_031002 · OH-1004

Mitochondrion0.084

Rank 4 · LXL04_031002 · OH-1004

Endoplasmic reticulum0.072

Rank 5 · LXL04_031002 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase147-382 aa

PF07714.24PK_Tyr_Ser-Thr155-332 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031002	`PF00069.32`	Pkinase	147	382	5.6e-55	187.3
LXL04_031002	`PF07714.24`	PK_Tyr_Ser-Thr	155	332	5.4e-33	115.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJV0`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase 6	73.371%	Swiss-Prot	strong database homology
`Q5QN75`	Oryza sativa subsp. japonica	Mitogen-activated protein kinase kinase 1	67.697%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card