LXL04_030998 | RubberDandelionOmics

Gene overview

LXL04_030998

Reference: OH-1004 Chr: Chr06 Coordinates: 126505897-126506514 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

618 bp · LXL04_030998|LXL04_030998|OH1004|cDNA

ATGGAAATTGAAGTAAAGCTCCGGTTACCTGACTCCGCCGCCCATCAGATACTTTCCGATTTACTCTCACCTTACCACACCAAAACCCACCTCCAACAAAACCTTTTCTTCGACACCCCATCACTCTCACTCGCCACCACTCACCGCGCCGCCCTCCGCCTCCGCTTCTACGACCTCGACTCCCAATCCATCCTCTCCCTTAAATCAAAACCCGTCATTTCCGATGGAATCAGCCGCATCGAAGAGGAGGAACAGTCACT...

CDS

Download CDS FASTA

618 bp · LXL04_030998|LXL04_030998|OH1004|CDS

ATGGAAATTGAAGTAAAGCTCCGGTTACCTGACTCCGCCGCCCATCAGATACTTTCCGATTTACTCTCACCTTACCACACCAAAACCCACCTCCAACAAAACCTTTTCTTCGACACCCCATCACTCTCACTCGCCACCACTCACCGCGCCGCCCTCCGCCTCCGCTTCTACGACCTCGACTCCCAATCCATCCTCTCCCTTAAATCAAAACCCGTCATTTCCGATGGAATCAGCCGCATCGAAGAGGAGGAACAGTCACT...

Protein

Download Protein FASTA

205 aa · LXL04_030998|LXL04_030998|OH1004|PROTEIN

MEIEVKLRLPDSAAHQILSDLLSPYHTKTHLQQNLFFDTPSLSLATTHRAALRLRFYDLDSQSILSLKSKPVISDGISRIEEEEQSLDPSLARACAAEPWRFSTIEKSKILKRVKEEFGVHPSELVSLGGFRNVRAVHMWNGLKLELDETQFDFGVNYEIECESNDPDEAKLMLEQLLNQNGITFSYSQASKFAIFRSGKLPEFK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030998`
TK1151 ID	TkA07G444280
OH-1004 ID	LXL04_030998
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030998

Location Chr06:126505897-126506514 (+)

Description Similar to TTM3: Triphosphate tunnel metalloenzyme 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g11890`	Involved in the hydrolysis of the beta-gamma-phosphoanhydride linkage of triphosphate-containing substrates (inorganic or nucleoside- linked).	Crystal structure and biochemical analyses reveal that the Arabidopsis triphosphate tunnel metalloenzyme AtTTM3 is a tripolyphosphatase involved in root development.2013 · DOI: 10.1111/tpj.12325

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030998 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005680 anaphase-promoting complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0050355 inorganic triphosphate phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT2G11890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.638

Rank 1 · LXL04_030998 · OH-1004

Cytoplasm0.485

Rank 2 · LXL04_030998 · OH-1004

Mitochondrion0.063

Rank 3 · LXL04_030998 · OH-1004

Plastid0.037

Rank 4 · LXL04_030998 · OH-1004

Peroxisome0.032

Rank 5 · LXL04_030998 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01928.27CYTH2-184 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030998	`PF01928.27`	CYTH	2	184	3.5e-19	70.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIY3`	Arabidopsis thaliana	Triphosphate tunnel metalloenzyme 3	50.000%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card