LXL04_030973 | RubberDandelionOmics

Gene overview

LXL04_030973

Reference: OH-1004 Chr: Chr06 Coordinates: 126140606-126145009 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1641 bp · LXL04_030973|LXL04_030973|OH1004|cDNA

ATGAGATATAGAACCGTAAATCCGTACCGGAACCGGAACCGAACCGAACTGAACCGAAACAGATTGCACCCAGATTACTATGAATCGGTTCAGCGCAGGTTTGAAATTAATGGCGAAGGATTTGAAGGTCAAATCGAAAAGGTAATGCAATTAATCGAGGAAGGAACCGTAGCTTGTGATTCTGAACCTGAGAGCTTAAAGGACTACACCATCCCCCATTACATACTGGTTCCTGAAtcaaaaattgaaaaaccatCACA...

CDS

Download CDS FASTA

1641 bp · LXL04_030973|LXL04_030973|OH1004|CDS

ATGAGATATAGAACCGTAAATCCGTACCGGAACCGGAACCGAACCGAACTGAACCGAAACAGATTGCACCCAGATTACTATGAATCGGTTCAGCGCAGGTTTGAAATTAATGGCGAAGGATTTGAAGGTCAAATCGAAAAGGTAATGCAATTAATCGAGGAAGGAACCGTAGCTTGTGATTCTGAACCTGAGAGCTTAAAGGACTACACCATCCCCCATTACATACTGGTTCCTGAATCAAAAATTGAAAAACCATCACA...

Protein

Download Protein FASTA

546 aa · LXL04_030973|LXL04_030973|OH1004|PROTEIN

MRYRTVNPYRNRNRTELNRNRLHPDYYESVQRRFEINGEGFEGQIEKVMQLIEEGTVACDSEPESLKDYTIPHYILVPESKIEKPSHVPSSPVIVFINSRSGGQLGGELLLSYQTLLNKNQVFDLNEKAPDKVLHQFFLNIEKHKRDGDSFASEIEKKLRVIVAGGDGTAGWILGVISDLNLSQPPPVATVPLGTGNNLPFAFGWGKKNPGTDHESVKMFLEQVRDAKEMKVDSWHVLMKMRVPKGEGSCDPIAPLELPH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030973`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030973

Location Chr06:126140606-126145009 (+)

Description Similar to DGK5: Diacylglycerol kinase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20900`	Phosphorylates the second messenger diacylglycerol (DAG) to generate phosphatidic acid (PA), another important signaling molecule.	No verified direct reference in this release
`At4g28130`	Phosphorylates the second messenger diacylglycerol (DAG) to generate phosphatidic acid (PA), another important signaling molecule.	No verified direct reference in this release
`At5g57690`	Phosphorylates the second messenger diacylglycerol (DAG) to generate phosphatidic acid (PA), another important signaling molecule.	A role for diacylglycerol kinase 4 in signalling crosstalk during Arabidopsis pollen tube growth.2019 · DOI: 10.1111/nph.15674 Arabidopsis DIACYLGLYCEROL KINASE4 is involved in nitric oxide-dependent pollen tube guidance and fertilization.2020 · DOI: 10.1242/dev.183715
`At2g18730`	Phosphorylates the second messenger diacylglycerol (DAG) to generate phosphatidic acid (PA), another important signaling molecule.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0634700`	Phosphorylates the second messenger diacylglycerol (DAG) to generate phosphatidic acid (PA), another important signaling molecule.	Overexpression of a rice diacylglycerol kinase gene OsBIDK1 enhances disease resistance in transgenic tobacco.2008 · PMID: 18679055 Diacylglycerol kinase and associated lipid mediators modulate rice root architecture.2019 · DOI: 10.1111/nph.15801

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030973 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046486 glycerolipid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004143 ATP-dependent diacylglycerol kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G18730

ath:AT2G20900

ath:AT4G28130

ath:AT5G57690

dosa:Os04g0634700

osa:4337126

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.391

Rank 1 · LXL04_030973 · OH-1004

Cell membrane0.297

Rank 2 · LXL04_030973 · OH-1004

Endoplasmic reticulum0.194

Rank 3 · LXL04_030973 · OH-1004

Nucleus0.166

Rank 4 · LXL04_030973 · OH-1004

Mitochondrion0.159

Rank 5 · LXL04_030973 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00781.30DAGK_cat92-217 aa

PF00609.25DAGK_acc286-460 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030973	`PF00781.30`	DAGK_cat	92	217	1.3e-20	74.0
LXL04_030973	`PF00609.25`	DAGK_acc	286	460	6.1e-35	121.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5E5`	Arabidopsis thaliana	Diacylglycerol kinase 5	65.083%	Swiss-Prot	strong database homology
`F4JKI3`	Arabidopsis thaliana	Diacylglycerol kinase 6	61.572%	Swiss-Prot	strong database homology
`Q1PDI2`	Arabidopsis thaliana	Diacylglycerol kinase 4	35.476%	Swiss-Prot	moderate database homology
`Q8VZG1`	Arabidopsis thaliana	Diacylglycerol kinase 3	35.880%	Swiss-Prot	moderate database homology
`Q7XQT2`	Oryza sativa subsp. japonica	Diacylglycerol kinase 1	64.170%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card