LXL04_030971 | RubberDandelionOmics

Gene overview

LXL04_030971

Reference: OH-1004 Chr: Chr06 Coordinates: 126048120-126050244 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

666 bp · LXL04_030971|LXL04_030971|OH1004|cDNA

ATGCTGTCCTACCATTTGAAACTTCTGTtCTCATTCAGACAGTTTATTCAGTCTGCATTTATTTCTTGTGTCAGGTACTACTCCATGTATGGACATGTAGAAAAGCTAGCTGAAGAGATAAAGAAAGGAGCTGCATCCGTTGAAGGAGTAGAAGCCAAACTATGGCAGGTCTCAGAGACATTACACGAAGAGGTGCTCGGTAAAATGAGCGCACCTCCTAAAAGCGATGTACCAATAATCACAGCAAGCGAACTGTCTGA...

CDS

Download CDS FASTA

666 bp · LXL04_030971|LXL04_030971|OH1004|CDS

ATGCTGTCCTACCATTTGAAACTTCTGTTCTCATTCAGACAGTTTATTCAGTCTGCATTTATTTCTTGTGTCAGGTACTACTCCATGTATGGACATGTAGAAAAGCTAGCTGAAGAGATAAAGAAAGGAGCTGCATCCGTTGAAGGAGTAGAAGCCAAACTATGGCAGGTCTCAGAGACATTACACGAAGAGGTGCTCGGTAAAATGAGCGCACCTCCTAAAAGCGATGTACCAATAATCACAGCAAGCGAACTGTCTGA...

Protein

Download Protein FASTA

221 aa · LXL04_030971|LXL04_030971|OH1004|PROTEIN

MLSYHLKLLFSFRQFIQSAFISCVRYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVSETLHEEVLGKMSAPPKSDVPIITASELSEADGFVFGFPTRFGMMSAQFKAFFDSTGGLWRTQQLAGKPAGIFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEQVKGGSPYGAGTYAGDGSRQPSELELAQAFHQGKHIATITKKLKGPVA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030971`
TK1151 ID	TkA07G442420
OH-1004 ID	LXL04_030971
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 69.231 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030971

Location Chr06:126048120-126050244 (-)

Description Similar to At4g27270: Probable NAD(P)H dehydrogenase (quinone) FQR1-like 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27270`	Catalyzes the transfer of electrons from NADH and NADPH to reduce quinone to the hydroquinone state.	No verified direct reference in this release
`At5g54500`	Catalyzes the transfer of electrons from NADH and NADPH to several quinones in vitro.	No verified direct reference in this release
`At4g36750`	Catalyzes the transfer of electrons from NADH and NADPH to reduce quinone to the hydroquinone state.	No verified direct reference in this release
`At5g58800`	Catalyzes the transfer of electrons from NADH and NADPH to reduce quinone to the hydroquinone state.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030971 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0071365 cellular response to auxin stimulus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT4G27270

ath:AT4G36750

ath:AT5G54500

ath:AT5G58800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.600

Rank 1 · LXL04_030971 · OH-1004

Nucleus0.228

Rank 2 · LXL04_030971 · OH-1004

Mitochondrion0.164

Rank 3 · LXL04_030971 · OH-1004

Extracellular0.085

Rank 4 · LXL04_030971 · OH-1004

Peroxisome0.084

Rank 5 · LXL04_030971 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00258.31Flavodoxin_125-155 aa

PF03358.21FMN_red34-162 aa

PF02525.23Flavodoxin_238-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030971	`PF00258.31`	Flavodoxin_1	25	155	1.6e-10	42.0
LXL04_030971	`PF03358.21`	FMN_red	34	162	3.3e-15	56.7
LXL04_030971	`PF02525.23`	Flavodoxin_2	38	147	8.8e-07	29.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NQE2`	Arabidopsis thaliana	Probable NAD(P)H dehydrogenase (quinone) FQR1-like 1	86.869%	Swiss-Prot	strong database homology
`Q9LSQ5`	Arabidopsis thaliana	NAD(P)H dehydrogenase (quinone) FQR1	86.869%	Swiss-Prot	strong database homology
`O23207`	Arabidopsis thaliana	Probable NAD(P)H dehydrogenase (quinone) FQR1-like 2	66.829%	Swiss-Prot	strong database homology
`Q9LUX9`	Arabidopsis thaliana	Probable NAD(P)H dehydrogenase (quinone) FQR1-like 3	63.590%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card