LXL04_030968 | RubberDandelionOmics

Gene overview

LXL04_030968

Reference: OH-1004 Chr: Chr06 Coordinates: 125872467-125875022 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1806 bp · LXL04_030968|LXL04_030968|OH1004|cDNA

ATGCCTGAGGCGCCAAACCTCGACGACTACAATCTCACcgagaaaaacaaaaaaactcTTCAATTTATCGAAGACGTCACCTCCAAACCCGACGACATCCAACGACAAGTCCTCATTGAAATCCTCTCCCAAAATGCCGACGTCGAATACCTAAATCGCCATGGTCTCTCCGGCGACACTGACCGTGAAAAGTTCAAAAAACTTGTCCCCGTTGTCACCTATGAAGATCTCCAAAACGATATTACACGTATCGCAAATGG...

CDS

Download CDS FASTA

1806 bp · LXL04_030968|LXL04_030968|OH1004|CDS

ATGCCTGAGGCGCCAAACCTCGACGACTACAATCTCACCGAGAAAAACAAAAAAACTCTTCAATTTATCGAAGACGTCACCTCCAAACCCGACGACATCCAACGACAAGTCCTCATTGAAATCCTCTCCCAAAATGCCGACGTCGAATACCTAAATCGCCATGGTCTCTCCGGCGACACTGACCGTGAAAAGTTCAAAAAACTTGTCCCCGTTGTCACCTATGAAGATCTCCAAAACGATATTACACGTATCGCAAATGG...

Protein

Download Protein FASTA

601 aa · LXL04_030968|LXL04_030968|OH1004|PROTEIN

MPEAPNLDDYNLTEKNKKTLQFIEDVTSKPDDIQRQVLIEILSQNADVEYLNRHGLSGDTDREKFKKLVPVVTYEDLQNDITRIANGDKSPIFSSHPISEFLTSSGTSGGERKLMPTIEDELGRRSLLYSLLMPVMNRFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKERPYDPYTNYTSPNETILCPDSYQSMYSQMLCGLCLNTQVLRVGAVFASGFIRAIRFLEKHWSLLTHDIRTGTLNSIITD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030968`
TK1151 ID	TkA07G442050
OH-1004 ID	LXL04_030968
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030968

Location Chr06:125872467-125875022 (-)

Description Similar to GH3.6: Indole-3-acetic acid-amido synthetase GH3.6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54510`	Catalyzes the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	DFL1, an auxin-responsive GH3 gene homologue, negatively regulates shoot cell elongation and lateral root formation, and positively regulates the light response of hypocotyl length.2001 · DOI: 10.1046/j.1365-313x.2001.00957.x Characterization of an Arabidopsis enzyme family that conjugates amino acids to indole-3-acetic acid.2005 · DOI: 10.1105/tpc.104.026690
`At4g27260`	Catalyzes the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	Characterization of an Arabidopsis enzyme family that conjugates amino acids to indole-3-acetic acid.2005 · DOI: 10.1105/tpc.104.026690
`At2g14960`	Catalyzes the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	Characterization of an Arabidopsis enzyme family that conjugates amino acids to indole-3-acetic acid.2005 · DOI: 10.1105/tpc.104.026690

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0785400`	May catalyze the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	No verified direct reference in this release
`Os05g0500900`	May catalyze the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030968 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010120 camalexin biosynthetic process Biological Process

GO:0140964 intracellular auxin homeostasis Biological Process

GO:1901183 positive regulation of camalexin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0010279 indole-3-acetic acid amido synthetase activity Molecular Function

GO:0016881 acid-amino acid ligase activity Molecular Function

KEGG gene cross-reference

ath:AT2G14960

ath:AT4G27260

ath:AT5G54510

dosa:Os01g0785400

dosa:Os05g0500900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.504

Rank 1 · LXL04_030968 · OH-1004

Nucleus0.403

Rank 2 · LXL04_030968 · OH-1004

Mitochondrion0.077

Rank 3 · LXL04_030968 · OH-1004

Peroxisome0.068

Rank 4 · LXL04_030968 · OH-1004

Plastid0.054

Rank 5 · LXL04_030968 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03321.20GH320-328 aa

PF23571.2GH3_M355-435 aa

PF23572.2GH3_C451-567 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030968	`PF03321.20`	GH3	20	328	2.3e-119	398.8
LXL04_030968	`PF23571.2`	GH3_M	355	435	2.2e-30	105.2
LXL04_030968	`PF23572.2`	GH3_C	451	567	1.2e-37	130.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSQ4`	Arabidopsis thaliana	Indole-3-acetic acid-amido synthetase GH3.6	78.922%	Swiss-Prot	strong database homology
`O81829`	Arabidopsis thaliana	Indole-3-acetic acid-amido synthetase GH3.5	78.105%	Swiss-Prot	strong database homology
`O82333`	Arabidopsis thaliana	Probable indole-3-acetic acid-amido synthetase GH3.1	66.780%	Swiss-Prot	strong database homology
`Q8LQM5`	Oryza sativa subsp. japonica	Probable indole-3-acetic acid-amido synthetase GH3.1	68.212%	Swiss-Prot	strong database homology
`Q60EJ6`	Oryza sativa subsp. japonica	Probable indole-3-acetic acid-amido synthetase GH3.4	67.568%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card