LXL04_030967 | RubberDandelionOmics

Gene overview

LXL04_030967

Reference: OH-1004 Chr: Chr06 Coordinates: 125840740-125841679 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

780 bp · LXL04_030967|LXL04_030967|OH1004|cDNA

ATGGGACGTGTCATTAGGGCTCAGCGTAAGGGAGCAGGCTCCGTCTTCAAGTCCCATACTCACCACCGGAAAGGTCCCGCCAGGTTTCGCAGCCTCGACTTCGGCGAACGCAATGGTTACCTCAAGGGTGTTATCACCGAAATCATCCACGATCCAGGACGTGGTGCTCCTCTAGCTCGCGTCACCTTCCGTCATCCATTCCGTTACAAGCACCAGAAGGAGCTTTTTGTCGCCGCCGAGGGCATGTACACCGGTCAGTT...

CDS

Download CDS FASTA

780 bp · LXL04_030967|LXL04_030967|OH1004|CDS

ATGGGACGTGTCATTAGGGCTCAGCGTAAGGGAGCAGGCTCCGTCTTCAAGTCCCATACTCACCACCGGAAAGGTCCCGCCAGGTTTCGCAGCCTCGACTTCGGCGAACGCAATGGTTACCTCAAGGGTGTTATCACCGAAATCATCCACGATCCAGGACGTGGTGCTCCTCTAGCTCGCGTCACCTTCCGTCATCCATTCCGTTACAAGCACCAGAAGGAGCTTTTTGTCGCCGCCGAGGGCATGTACACCGGTCAGTT...

Protein

Download Protein FASTA

259 aa · LXL04_030967|LXL04_030967|OH1004|PROTEIN

MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVITEIIHDPGRGAPLARVTFRHPFRYKHQKELFVAAEGMYTGQFVFCGKKANLMVGNVLPLRSIPEGAVVCNVEHHVGDRGSFARASGDYAIVISHNPDNGTTRVKLPSGAKKIVPSGCRAMIGQVAGGGRTEKPMLKAGNAYHKFRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAARRTGRLRGQAAATAAKADK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030967`
TK1151 ID	TkA07G442020
OH-1004 ID	LXL04_030967
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030967

Location Chr06:125840740-125841679 (-)

Description Similar to RPL8: 60S ribosomal protein L8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36130`	Large ribosomal subunit protein uL2x.	No verified direct reference in this release
`At2g18020`	Large ribosomal subunit protein uL2z.	No verified direct reference in this release
`At3g51190`	Large ribosomal subunit protein uL2y.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030967 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G18020

ath:AT3G51190

ath:AT4G36130

nta:107816448

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.845

Rank 1 · LXL04_030967 · OH-1004

Nucleus0.189

Rank 2 · LXL04_030967 · OH-1004

Endoplasmic reticulum0.072

Rank 3 · LXL04_030967 · OH-1004

Plastid0.040

Rank 4 · LXL04_030967 · OH-1004

Mitochondrion0.037

Rank 5 · LXL04_030967 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00181.31Ribosomal_L2_N2-90 aa

PF03947.25Ribosomal_L2_C98-224 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030967	`PF00181.31`	Ribosomal_L2_N	2	90	8.2e-23	81.0
LXL04_030967	`PF03947.25`	Ribosomal_L2_C	98	224	2.8e-46	157.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42064`	Arabidopsis thaliana	Large ribosomal subunit protein uL2x	92.248%	Swiss-Prot	strong database homology
`P46286`	Arabidopsis thaliana	Large ribosomal subunit protein uL2z	93.023%	Swiss-Prot	strong database homology
`Q4PSL7`	Arabidopsis thaliana	Large ribosomal subunit protein uL2y	86.192%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card