LXL04_030956 | RubberDandelionOmics

Gene overview

LXL04_030956

Reference: OH-1004 Chr: Chr06 Coordinates: 125612790-125614168 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

342 bp · LXL04_030956|LXL04_030956|OH1004|cDNA

ATGTCTGACCTCGACATTCAGATTCCTAGTGCCTTGGACCCGTTTGCTGAAGCAAATGCTGAGGATTCTGGTGCTGGATCAAAAGAGTATGTGCACATTCGTGTTCAACAGAGAAATGGTAGGAAAAGTTTGACGACTGTTCAAGGGCTAAAAAAGGAATTTAGCTACAACAAGATTTTAAAGGATCTTAAAAAGGAATTTTGCTGCAATGGTACTGTTGTTCAAGACCCCGAATTAGGCCAGGTCATTCAGCTCCAAGG...

CDS

Download CDS FASTA

342 bp · LXL04_030956|LXL04_030956|OH1004|CDS

ATGTCTGACCTCGACATTCAGATTCCTAGTGCCTTGGACCCGTTTGCTGAAGCAAATGCTGAGGATTCTGGTGCTGGATCAAAAGAGTATGTGCACATTCGTGTTCAACAGAGAAATGGTAGGAAAAGTTTGACGACTGTTCAAGGGCTAAAAAAGGAATTTAGCTACAACAAGATTTTAAAGGATCTTAAAAAGGAATTTTGCTGCAATGGTACTGTTGTTCAAGACCCCGAATTAGGCCAGGTCATTCAGCTCCAAGG...

Protein

Download Protein FASTA

113 aa · LXL04_030956|LXL04_030956|OH1004|PROTEIN

MSDLDIQIPSALDPFAEANAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLTQAGIVKKDHIKIHGF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030956`
TK1151 ID	TkA07G441270
OH-1004 ID	LXL04_030956
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030956

Location Chr06:125612790-125614168 (-)

Description Similar to GOS2: Protein translation factor SUI1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g54290`	Probably involved in translation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0529800`	Probably involved in translation.	No verified direct reference in this release
`UniProt: A6MZM2`	Probably involved in translation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030956 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006417 regulation of translation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0003743 translation initiation factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G54290

dosa:Os07g0529800

zma:541664

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.636

Rank 1 · LXL04_030956 · OH-1004

Nucleus0.429

Rank 2 · LXL04_030956 · OH-1004

Endoplasmic reticulum0.075

Rank 3 · LXL04_030956 · OH-1004

Cell membrane0.068

Rank 4 · LXL04_030956 · OH-1004

Mitochondrion0.038

Rank 5 · LXL04_030956 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01253.28SUI128-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030956	`PF01253.28`	SUI1	28	102	3.5e-27	95.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94JV4`	Arabidopsis thaliana	Protein translation factor SUI1 homolog 2	87.611%	Swiss-Prot	strong database homology
`Q0D5W6`	Oryza sativa subsp. japonica	Protein translation factor SUI1 homolog	90.435%	Swiss-Prot	strong database homology
`A6MZM2`	Oryza sativa subsp. indica	Protein translation factor SUI1 homolog	90.435%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card