LXL04_030955 | RubberDandelionOmics

Gene overview

LXL04_030955

Reference: OH-1004 Chr: Chr06 Coordinates: 125610367-125611905 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1302 bp · LXL04_030955|LXL04_030955|OH1004|cDNA

ATGTTTGTGATAAAAATATCTAAAAGGTATAAAAAATGTATCTATCAATCACTCtcaataaaaatccaaaaaagtAGTGGTAAAGAGCATAGTAACCATTCTACACCTTTCGCACCATATCCTTCCCTCCCTTCGTCGCGATACTCAATTTTCCGTCGCTATAAATCCCCACACCCGTCGCCAATATTCCTCCGTTCATCTCCCCACCACCATATTAACTCCTTTCTCAGATCATCAACGGCGGCCATGGCTACCACCTT...

CDS

Download CDS FASTA

1302 bp · LXL04_030955|LXL04_030955|OH1004|CDS

ATGTTTGTGATAAAAATATCTAAAAGGTATAAAAAATGTATCTATCAATCACTCTCAATAAAAATCCAAAAAAGTAGTGGTAAAGAGCATAGTAACCATTCTACACCTTTCGCACCATATCCTTCCCTCCCTTCGTCGCGATACTCAATTTTCCGTCGCTATAAATCCCCACACCCGTCGCCAATATTCCTCCGTTCATCTCCCCACCACCATATTAACTCCTTTCTCAGATCATCAACGGCGGCCATGGCTACCACCTT...

Protein

Download Protein FASTA

433 aa · LXL04_030955|LXL04_030955|OH1004|PROTEIN

MFVIKISKRYKKCIYQSLSIKIQKSSGKEHSNHSTPFAPYPSLPSSRYSIFRRYKSPHPSPIFLRSSPHHHINSFLRSSTAAMATTFTTSISTKANSNFLEQSSFHGVQISSPIRLQPLKSTHNKMSITMSAASYDLNSFTFAPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDELEIEYDEQEHYVVIKHAALFTSTIMSKLLAR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030955`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030955

Location Chr06:125610367-125611905 (-)

Description Similar to THI1-1: Thiamine thiazole synthase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54770`	Involved in biosynthesis of the thiamine precursor thiazole.	Point mutation is responsible for Arabidopsis tz-201 mutant phenotype affecting thiamin biosynthesis.2003 · DOI: 10.1093/pcp/pcg104 THI1, a protein involved in the biosynthesis of thiamin in Arabidopsis thaliana: structural analysis of THI1(A140V) mutant.2014 · DOI: 10.1016/j.bbapap.2014.03.005 THI1, a Thiamine Thiazole Synthase, Interacts with Ca2+-Dependent Protein Kinase CPK33 and Modulates the S-Type Anion Channels and Stomatal Closure in Arabidopsis.2016 · DOI: 10.1104/pp.15.01649 Thi1, a thiamine biosynthetic gene in Arabidopsis thaliana, complements bacterial defects in DNA repair.1996 · DOI: 10.1007/bf00042231

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030955 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006974 DNA damage response Biological Process

GO:0009228 thiamine biosynthetic process Biological Process

GO:0009409 response to cold Biological Process

GO:0052837 thiazole biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT5G54770

cit:102626594

vvi:100260728

vvi:100265774

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.943

Rank 1 · LXL04_030955 · OH-1004

Mitochondrion0.078

Rank 2 · LXL04_030955 · OH-1004

Nucleus0.028

Rank 3 · LXL04_030955 · OH-1004

Cytoplasm0.027

Rank 4 · LXL04_030955 · OH-1004

Cell membrane0.013

Rank 5 · LXL04_030955 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01946.24Thi4151-384 aa

PF00890.31FAD_binding_2169-205 aa

PF01266.31DAO169-214 aa

PF07992.21Pyr_redox_2169-224 aa

PF13450.13NAD_binding_8172-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030955	`PF01946.24`	Thi4	151	384	1.1e-112	375.7
LXL04_030955	`PF00890.31`	FAD_binding_2	169	205	2.5e-09	37.6
LXL04_030955	`PF01266.31`	DAO	169	214	1.2e-08	35.6
LXL04_030955	`PF07992.21`	Pyr_redox_2	169	224	4.5e-06	27.0
LXL04_030955	`PF13450.13`	NAD_binding_8	172	207	2.4e-07	31.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38814`	Arabidopsis thaliana	Thiamine thiazole synthase, chloroplastic	80.056%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card