LXL04_030929 | RubberDandelionOmics

Gene overview

LXL04_030929

Reference: OH-1004 Chr: Chr06 Coordinates: 125345148-125349278 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1794 bp · LXL04_030929|LXL04_030929|OH1004|cDNA

ATGGCTTCCGGAGTTTTTCCAACCTTTTCTCCACATCACATCGGAGAAACCCCTAAAATATCAAAAGTGTCGTATTCAAAACTTGAAATTGGTCGTAAAACACTATGCTCAAAGTCCCGCCATTCCAGGTTCCTGAAGCTCACAGCTAACGCAAAAACAACCCAATCAGATTCCGATCGCGATCACGATCACGACCCACTTGGGAAATTTCTTAAAAGAGATTACGATTCCAAATATGGATTCAGTCAAAAAGTCGATTC...

CDS

Download CDS FASTA

1794 bp · LXL04_030929|LXL04_030929|OH1004|CDS

ATGGCTTCCGGAGTTTTTCCAACCTTTTCTCCACATCACATCGGAGAAACCCCTAAAATATCAAAAGTGTCGTATTCAAAACTTGAAATTGGTCGTAAAACACTATGCTCAAAGTCCCGCCATTCCAGGTTCCTGAAGCTCACAGCTAACGCAAAAACAACCCAATCAGATTCCGATCGCGATCACGATCACGACCCACTTGGGAAATTTCTTAAAAGAGATTACGATTCCAAATATGGATTCAGTCAAAAAGTCGATTC...

Protein

Download Protein FASTA

597 aa · LXL04_030929|LXL04_030929|OH1004|PROTEIN

MASGVFPTFSPHHIGETPKISKVSYSKLEIGRKTLCSKSRHSRFLKLTANAKTTQSDSDRDHDHDPLGKFLKRDYDSKYGFSQKVDSFTIPKGLSEDTIRLISSTKKEPHWMLEFRLNSYHKFCQMTEPNWSDNDYPKIDFQNMSYYSEPKKKPTLNSLNEVDPEVIKTFDKLGIPLTEQKRLANVAVDAVFDSVSIATTHSKTLSKSGVIFCSISDAIKTHPNLIKKYLGKVVPPDDNFFAALNSAVFTDGTFVYIPKN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030929`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030929

Location Chr06:125345148-125349278 (-)

Description Similar to ABCI8: UPF0051 protein ABCI8, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04770`	Involved in light signaling, probably by mediating the transport and correct distribution of protoporphyrin IX, a chlorophyll precursor, in response to far-red light.	A plastidic ABC protein involved in intercompartmental communication of light signaling.2001 · DOI: 10.1101/gad.850101

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030929 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:2000030 regulation of response to red or far red light Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:1990229 iron-sulfur cluster assembly complex Cellular Component

GO:0042626 ATPase-coupled transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G04770

syn:slr0074

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.882

Rank 1 · LXL04_030929 · OH-1004

Mitochondrion0.124

Rank 2 · LXL04_030929 · OH-1004

Cytoplasm0.059

Rank 3 · LXL04_030929 · OH-1004

Peroxisome0.028

Rank 4 · LXL04_030929 · OH-1004

Nucleus0.023

Rank 5 · LXL04_030929 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19295.6SufBD_N191-265 aa

PF01458.24SUFBD_core271-470 aa

PF01458.24SUFBD_core527-568 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030929	`PF19295.6`	SufBD_N	191	265	1.1e-13	52.0
LXL04_030929	`PF01458.24`	SUFBD_core	271	470	6.6e-68	229.4
LXL04_030929	`PF01458.24`	SUFBD_core	527	568	6.6e-68	229.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZS97`	Arabidopsis thaliana	Iron-sulfur cluster assembly SufBD family protein ABCI8, chloroplastic	69.508%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card