LXL04_030909 | RubberDandelionOmics

Gene overview

LXL04_030909

Reference: OH-1004 Chr: Chr06 Coordinates: 124985860-124987268 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1194 bp · LXL04_030909|LXL04_030909|OH1004|cDNA

ATGGAGAGCATGTTCTTGAGCAACAAAGTTACCATGAATTCGAGAAATGAAGCAATGAGAAAGAGTTGGGCGATGGTGATGGGAGGAAACACGTCGTTCCACTACGGAGGATTAAGCGTTTGGAAGAAGGGCTACGGTTACAATGGTTTCAAAGTTGGTAGAAATCCATCCAACAACCACCGTCACCGTCAGAGCAAAGGAGTGATGAACGTGAAGGGAGAAGAAAATGATTTGCTGAACTTTACGTACGAGGGTGGGTT...

CDS

Download CDS FASTA

1194 bp · LXL04_030909|LXL04_030909|OH1004|CDS

ATGGAGAGCATGTTCTTGAGCAACAAAGTTACCATGAATTCGAGAAATGAAGCAATGAGAAAGAGTTGGGCGATGGTGATGGGAGGAAACACGTCGTTCCACTACGGAGGATTAAGCGTTTGGAAGAAGGGCTACGGTTACAATGGTTTCAAAGTTGGTAGAAATCCATCCAACAACCACCGTCACCGTCAGAGCAAAGGAGTGATGAACGTGAAGGGAGAAGAAAATGATTTGCTGAACTTTACGTACGAGGGTGGGTT...

Protein

Download Protein FASTA

397 aa · LXL04_030909|LXL04_030909|OH1004|PROTEIN

MESMFLSNKVTMNSRNEAMRKSWAMVMGGNTSFHYGGLSVWKKGYGYNGFKVGRNPSNNHRHRQSKGVMNVKGEENDLLNFTYEGGFPALEGEDNEMIFDGVKYTLKTESKFARRVFISGSPNISPQMKMDQTIWRHALLSISGRNQNPRYVSLTPNIIADVLPPLDSHGVVDIKELCKSIGGKQFVAVYLDPIQGVGDLRGFDRSDMLALGDACRGSKTLLVVDETVCGLGRTGDLWGHDSFGIKPDVMLVDFGPKLGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030909`
TK1151 ID	TkA07G440100
OH-1004 ID	LXL04_030909
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	75.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030909

Location Chr06:124985860-124987268 (-)

Description Similar to AG118: Acetylornithine aminotransferase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80600`	Involved in the biosynthesis of citrulline (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030909 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006526 L-arginine biosynthetic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048364 root development Biological Process

GO:0080022 primary root development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003992 N2-acetyl-L-ornithine:2-oxoglutarate 5-aminotransferase activity Molecular Function

GO:0005507 copper ion binding Molecular Function

GO:0030170 pyridoxal phosphate binding Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G80600

syn:slr1022

tel:tlr1328

tma:TM1785

tmi:THEMA_05275

tmm:Tmari_1794

tmw:THMA_1829

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.919

Rank 1 · LXL04_030909 · OH-1004

Mitochondrion0.082

Rank 2 · LXL04_030909 · OH-1004

Nucleus0.031

Rank 3 · LXL04_030909 · OH-1004

Cytoplasm0.024

Rank 4 · LXL04_030909 · OH-1004

Cell membrane0.012

Rank 5 · LXL04_030909 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00202.28Aminotran_3182-393 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030909	`PF00202.28`	Aminotran_3	182	393	5.4e-23	82.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8M7`	Arabidopsis thaliana	Acetylornithine aminotransferase, chloroplastic/mitochondrial	31.628%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card