LXL04_030906 | RubberDandelionOmics

Gene overview

LXL04_030906

Reference: OH-1004 Chr: Chr06 Coordinates: 124896873-124899008 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1290 bp · LXL04_030906|LXL04_030906|OH1004|cDNA

ATGCTTAAAACCGCCATTGAGATCAGTTCCCGACGGGGATTGATCTGCACGTATTGTGAGGCGAAGAAATCGGGGAAGAAATTAGAATTACCATCGTTGTTGAAAGGGAAGAGAAGGCGTAGAACTGCAAAAGAAAACCTTCTTTCAAGTGATTTGTGGGCAGTCCGGATTCAAAGTTTATGGAAAGATGTCGATGGTAGCTTCTGGTTTCGGGGTCAATGGTATATAATCCCCGAGGAAACATCTGCAGGCAGACAACC...

CDS

Download CDS FASTA

1290 bp · LXL04_030906|LXL04_030906|OH1004|CDS

ATGCTTAAAACCGCCATTGAGATCAGTTCCCGACGGGGATTGATCTGCACGTATTGTGAGGCGAAGAAATCGGGGAAGAAATTAGAATTACCATCGTTGTTGAAAGGGAAGAGAAGGCGTAGAACTGCAAAAGAAAACCTTCTTTCAAGTGATTTGTGGGCAGTCCGGATTCAAAGTTTATGGAAAGATGTCGATGGTAGCTTCTGGTTTCGGGGTCAATGGTATATAATCCCCGAGGAAACATCTGCAGGCAGACAACC...

Protein

Download Protein FASTA

429 aa · LXL04_030906|LXL04_030906|OH1004|PROTEIN

MLKTAIEISSRRGLICTYCEAKKSGKKLELPSLLKGKRRRRTAKENLLSSDLWAVRIQSLWKDVDGSFWFRGQWYIIPEETSAGRQPHNLKRELYRTNDFADNEMETVLRHCYVMPPNEYAKASNEGDDVFLCEYEYDVKWHSFKRILETDNNEEDEEEAEHDDDWSGDEDSDSETDDDMEYEKEDTYKPTSTHKMAANSRKGCTFGLGKIGTKKIPEHVRCHKQIELEKAKATLLLATLPKSLPCRNKEMEEITTFIKG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030906`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030906

Location Chr06:124896873-124899008 (+)

Description Similar to ORC1: Origin of replication complex subunit 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14700`	Essential protein.	No verified direct reference in this release
`At4g12620`	Essential protein required for ovules fertilization.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0187000`	Essential protein (By similarity).	Molecular cloning and characterization of a plant homologue of the origin recognition complex 1 (ORC1).2000 · DOI: 10.1016/s0168-9452(00)00297-1

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030906 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0009744 response to sucrose Biological Process

GO:0033314 mitotic DNA replication checkpoint signaling Biological Process

GO:0000808 origin recognition complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005664 nuclear origin of replication recognition complex Cellular Component

GO:0003682 chromatin binding Molecular Function

GO:0003688 DNA replication origin binding Molecular Function

KEGG gene cross-reference

ath:AT4G12620

ath:AT4G14700

dosa:Os06g0187000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.729

Rank 1 · LXL04_030906 · OH-1004

Cytoplasm0.260

Rank 2 · LXL04_030906 · OH-1004

Mitochondrion0.065

Rank 3 · LXL04_030906 · OH-1004

Cell membrane0.040

Rank 4 · LXL04_030906 · OH-1004

Endoplasmic reticulum0.025

Rank 5 · LXL04_030906 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01426.25BAH55-146 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030906	`PF01426.25`	BAH	55	146	5.3e-15	56.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q710E8`	Arabidopsis thaliana	Origin of replication complex subunit 1A	59.615%	Swiss-Prot	moderate database homology
`Q9SU24`	Arabidopsis thaliana	Origin of replication complex subunit 1B	57.414%	Swiss-Prot	moderate database homology
`Q5SMU7`	Oryza sativa subsp. japonica	Origin of replication complex subunit 1	61.111%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card