LXL04_030879 | RubberDandelionOmics

Gene overview

LXL04_030879

Reference: OH-1004 Chr: Chr06 Coordinates: 124484433-124485223 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

564 bp · LXL04_030879|LXL04_030879|OH1004|cDNA

ATGTTTGCTGTGATGAAACCCACTCGTGGCATTTTGTTAGTCGGGCCCATAGGGTGTGGGAAAACTAAAATTGCCCATGCCTTTGGTGCAGTAAGAGATCTATTTTCAAAGGCATGTCAAAAAACACCGTCAATTGTGTTCATAAATCATATCGAAGTAATTGCTGGAAATTTTAAAGTGGAAATCGAAAAGCCGTTGCTGAATGAACTAGTGAGATGTATGGATAATCCCCGAAATAACAAAGTGTTGGTGATAGCGGT...

CDS

Download CDS FASTA

564 bp · LXL04_030879|LXL04_030879|OH1004|CDS

ATGTTTGCTGTGATGAAACCCACTCGTGGCATTTTGTTAGTCGGGCCCATAGGGTGTGGGAAAACTAAAATTGCCCATGCCTTTGGTGCAGTAAGAGATCTATTTTCAAAGGCATGTCAAAAAACACCGTCAATTGTGTTCATAAATCATATCGAAGTAATTGCTGGAAATTTTAAAGTGGAAATCGAAAAGCCGTTGCTGAATGAACTAGTGAGATGTATGGATAATCCCCGAAATAACAAAGTGTTGGTGATAGCGGT...

Protein

Download Protein FASTA

187 aa · LXL04_030879|LXL04_030879|OH1004|PROTEIN

MFAVMKPTRGILLVGPIGCGKTKIAHAFGAVRDLFSKACQKTPSIVFINHIEVIAGNFKVEIEKPLLNELVRCMDNPRNNKVLVIAVTDIPQILDPAIKRRGRFEREIYIGLPDETARLKMLEIVIRGTVVEDNIDFKDESRVLAYQAVQRGRNEAVSHHNAGSRDGSEANAIFFPASEISSTFSFV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030879`
TK1151 ID	TkA07G438280
OH-1004 ID	LXL04_030879
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030879

Location Chr06:124484433-124485223 (+)

Description Similar to CDC48C: Cell division control protein 48 homolog C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01610`	Probably functions in cell division and growth processes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030879 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006364 rRNA processing Biological Process

GO:0015031 protein transport Biological Process

GO:0032092 positive regulation of protein binding Biological Process

GO:0032206 positive regulation of telomere maintenance Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0042273 ribosomal large subunit biogenesis Biological Process

GO:0051301 cell division Biological Process

GO:1904749 regulation of protein localization to nucleolus Biological Process

GO:1905323 telomerase holoenzyme complex assembly Biological Process

GO:0000176 nuclear exosome (RNase complex) Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G01610

hsa:4931

mmu:67459

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.451

Rank 1 · LXL04_030879 · OH-1004

Nucleus0.346

Rank 2 · LXL04_030879 · OH-1004

Mitochondrion0.111

Rank 3 · LXL04_030879 · OH-1004

Peroxisome0.066

Rank 4 · LXL04_030879 · OH-1004

Cell membrane0.054

Rank 5 · LXL04_030879 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00004.36AAA30-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030879	`PF00004.36`	AAA	30	112	4.4e-19	69.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SS94`	Arabidopsis thaliana	Cell division control protein 48 homolog C	33.333%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card