LXL04_030851 | RubberDandelionOmics

Gene overview

LXL04_030851

Reference: OH-1004 Chr: Chr06 Coordinates: 124133693-124135835 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

858 bp · LXL04_030851|LXL04_030851|OH1004|cDNA

ATGTGTATGGGACCACCAAGTGGGTGGAGCAGAGCTCGAGGGTTAGTGGTGAAGACGCTGGTTTTGATCGGAGGTGCTCTTTTGGTTAAGCGATTAACCAAGTCCACCACTCGTTGGGACCATGCTCGCATCGTTTCTCAATCCATCGCCGGCGAAAAGTTCTCGAAGGAACAAGCATCCAGAGATCCCGATAATTTCTTCAATTTAAGGTATTACTCTCTCCACTTTGCAAATTCTCATATCACTTATGTTGTTGATAA...

CDS

Download CDS FASTA

858 bp · LXL04_030851|LXL04_030851|OH1004|CDS

ATGTGTATGGGACCACCAAGTGGGTGGAGCAGAGCTCGAGGGTTAGTGGTGAAGACGCTGGTTTTGATCGGAGGTGCTCTTTTGGTTAAGCGATTAACCAAGTCCACCACTCGTTGGGACCATGCTCGCATCGTTTCTCAATCCATCGCCGGCGAAAAGTTCTCGAAGGAACAAGCATCCAGAGATCCCGATAATTTCTTCAATTTAAGGTATTACTCTCTCCACTTTGCAAATTCTCATATCACTTATGTTGTTGATAA...

Protein

Download Protein FASTA

285 aa · LXL04_030851|LXL04_030851|OH1004|PROTEIN

MCMGPPSGWSRARGLVVKTLVLIGGALLVKRLTKSTTRWDHARIVSQSIAGEKFSKEQASRDPDNFFNLRYYSLHFANSHITYVVDNFFNLRWLSCPAADMVDGSKVLYFEQAFWRTPNKPFRQRFCMVKPCPKEMKCDVELSTYAIRDAEEYKNFCDRPRDQRPQPEEVIGDVAEHLTTIYLNRCERGKRCLYEGSTPPDGFPNSWNGAAYCTSQLAVLKNNEVHMWDRGYDDDGNQVWGVKNGPYEFKAAPGPASAPA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030851`
TK1151 ID	TkA07G437080
OH-1004 ID	LXL04_030851
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030851

Location Chr06:124133693-124135835 (+)

Description Similar to CRL: Chromophore lyase CRL, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51020`	Covalently attaches a chromophore to Cys residue(s) of phycobiliproteins (By similarity).	The chloroplast division mutant caa33 of Arabidopsis thaliana reveals the crucial impact of chloroplast homeostasis on stress acclimation and retrograde plastid-to-nucleus signaling.2012 · DOI: 10.1111/j.1365-313x.2011.04825.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030851 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0006952 defense response Biological Process

GO:0010020 chloroplast fission Biological Process

GO:0017006 protein-tetrapyrrole linkage Biological Process

GO:0043572 plastid fission Biological Process

GO:0046741 transport of virus in host, tissue to tissue Biological Process

GO:0051301 cell division Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0098586 cellular response to virus Biological Process

GO:0005634 nucleus Cellular Component

GO:0009536 plastid Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

KEGG gene cross-reference

ath:AT5G51020

gvi:glr0438

mar:MAE_22830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.419

Rank 1 · LXL04_030851 · OH-1004

Endoplasmic reticulum0.143

Rank 2 · LXL04_030851 · OH-1004

Cytoplasm0.123

Rank 3 · LXL04_030851 · OH-1004

Golgi apparatus0.108

Rank 4 · LXL04_030851 · OH-1004

Mitochondrion0.102

Rank 5 · LXL04_030851 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06206.18CpeT46-250 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030851	`PF06206.18`	CpeT	46	250	3.1e-40	138.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FI46`	Arabidopsis thaliana	Chromophore lyase CRL, chloroplastic	70.000%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card