LXL04_030843 | RubberDandelionOmics

Gene overview

LXL04_030843

Reference: OH-1004 Chr: Chr06 Coordinates: 124052055-124054503 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1014 bp · LXL04_030843|LXL04_030843|OH1004|cDNA

ATGGCAGATGAAGTATGTGACaacggtggcagtggtggtaGCTCGCCCAACAAGGTGGTGGTTGACGGGCAGCAACCACCGCCCacggtggtggaggtggtggaggatAAGAACAAATCGCCACGACACCCACGTTGGACCCGACAAGAAACACTTACACTCATAGAAGGAAAGAAAGTTGCAGAAAACAGAGGCCGTCGGGGCCGGAGATCATCAAGTTCGGTTTTCGGGTCAGACCAAATCGAACCCAAGTGGGATTC...

CDS

Download CDS FASTA

1014 bp · LXL04_030843|LXL04_030843|OH1004|CDS

ATGGCAGATGAAGTATGTGACAACGGTGGCAGTGGTGGTAGCTCGCCCAACAAGGTGGTGGTTGACGGGCAGCAACCACCGCCCACGGTGGTGGAGGTGGTGGAGGATAAGAACAAATCGCCACGACACCCACGTTGGACCCGACAAGAAACACTTACACTCATAGAAGGAAAGAAAGTTGCAGAAAACAGAGGCCGTCGGGGCCGGAGATCATCAAGTTCGGTTTTCGGGTCAGACCAAATCGAACCCAAGTGGGATTC...

Protein

Download Protein FASTA

337 aa · LXL04_030843|LXL04_030843|OH1004|PROTEIN

MADEVCDNGGSGGSSPNKVVVDGQQPPPTVVEVVEDKNKSPRHPRWTRQETLTLIEGKKVAENRGRRGRRSSSSVFGSDQIEPKWDSVSSYCKQHAVNRGPVQCRKRWSNMVGDFKKIKAWESQLKHESESYWVMRNDLRKENKLPGFFDREVFDVLDGKAFTTAAYQLAVVTVSADTQDELMAVVAGEEEDEEEGEAEVVFDSGRRDDGLFPESEKVEEEADGEGDGDRTPESPNPMPISGTLNDHQTNSVPWKKHCTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030843`
TK1151 ID	TkA07G436890
OH-1004 ID	LXL04_030843
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030843

Location Chr06:124052055-124054503 (-)

Description Similar to ASR3: Trihelix transcription factor ASR3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g33550`	Transcriptional repressor that binds DNA and plays a negative role in regulating microbe-associated molecular patterns-(MAMPs, e.g. flg22, elf18, chitin, and LPS) triggered immunity (PTI) by negatively regulating immune gene expression.	Phosphorylation of trihelix transcriptional repressor ASR3 by MAP KINASE4 negatively regulates Arabidopsis immunity.2015 · DOI: 10.1105/tpc.114.134809

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030843 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0050777 negative regulation of immune response Biological Process

GO:0071219 cellular response to molecule of bacterial origin Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT2G33550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.979

Rank 1 · LXL04_030843 · OH-1004

Cytoplasm0.068

Rank 2 · LXL04_030843 · OH-1004

Cell membrane0.022

Rank 3 · LXL04_030843 · OH-1004

Endoplasmic reticulum0.012

Rank 4 · LXL04_030843 · OH-1004

Plastid0.009

Rank 5 · LXL04_030843 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13837.13Myb_DNA-bind_444-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030843	`PF13837.13`	Myb_DNA-bind_4	44	135	2.7e-10	41.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZ20`	Arabidopsis thaliana	Trihelix transcription factor ASR3	41.337%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card