LXL04_030842 | RubberDandelionOmics

Gene overview

LXL04_030842

Reference: OH-1004 Chr: Chr06 Coordinates: 124049683-124051548 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1866 bp · LXL04_030842|LXL04_030842|OH1004|cDNA

ATGCTAACTGTCTGTGACATTCTTTCATCTTCCACAAACATAATACCAGGTTATGAAACAGATTACTATTGGGTCCTTCAACTTATGCCTTCTTCCAATCTCTCTGATATAACCTCACAATATCAAAAACTAACCTCCTTATTGCAACCAATAAAATACAAATTCCCTGCTACCGAAACCGCCCTTAAACTTTTACAAGACGCGTATTCTGTCCTTTCCGATAAAAAAAAACGTGTCACTTTTGATATAAAACGAGGTAT...

CDS

Download CDS FASTA

1866 bp · LXL04_030842|LXL04_030842|OH1004|CDS

ATGCTAACTGTCTGTGACATTCTTTCATCTTCCACAAACATAATACCAGGTTATGAAACAGATTACTATTGGGTCCTTCAACTTATGCCTTCTTCCAATCTCTCTGATATAACCTCACAATATCAAAAACTAACCTCCTTATTGCAACCAATAAAATACAAATTCCCTGCTACCGAAACCGCCCTTAAACTTTTACAAGACGCGTATTCTGTCCTTTCCGATAAAAAAAAACGTGTCACTTTTGATATAAAACGAGGTAT...

Protein

Download Protein FASTA

621 aa · LXL04_030842|LXL04_030842|OH1004|PROTEIN

MLTVCDILSSSTNIIPGYETDYYWVLQLMPSSNLSDITSQYQKLTSLLQPIKYKFPATETALKLLQDAYSVLSDKKKRVTFDIKRGISWVNYESFETNGVDNNNGDKVHVNNITLQESGGSSSSEVVSEGQKGQFTDINSGTQKVQDKTIQQDYYSFDSFRTPECFTLKDIWAVHCCLSEPFIGGRYGQIYKRLGGVTEITWLKPIPVTEGERRWFDAGLPVACGSFCLDTEPITIESKGVFSYKCAWDPGVTEELFEIY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030842`
TK1151 ID	TkA07G436880
OH-1004 ID	LXL04_030842
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 93.103 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_030842`
Location	Chr06:124049683-124051548 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030842` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006260 DNA replication Biological Process GO:0009408 response to heat Biological Process GO:0042026 protein refolding Biological Process GO:0005737 cytoplasm Cellular Component GO:0005524 ATP binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0031072 heat shock protein binding Molecular Function GO:0051082 unfolded protein binding Molecular Function
KEGG gene cross-reference	hde:HDEF_0371 mma:MM_2504 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.837

Rank 1 · LXL04_030842 · OH-1004

Cytoplasm0.204

Rank 2 · LXL04_030842 · OH-1004

Cell membrane0.045

Rank 3 · LXL04_030842 · OH-1004

Endoplasmic reticulum0.030

Rank 4 · LXL04_030842 · OH-1004

Plastid0.017

Rank 5 · LXL04_030842 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226.37DnaJ21-82 aa

PF11926.14DUF3444150-353 aa

PF11926.14DUF3444411-597 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030842	`PF00226.37`	DnaJ	21	82	3.6e-10	40.5
LXL04_030842	`PF11926.14`	DUF3444	150	353	3.9e-89	298.5
LXL04_030842	`PF11926.14`	DUF3444	411	597	3.9e-89	298.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card