LXL04_030766 | RubberDandelionOmics

Gene overview

LXL04_030766

Reference: OH-1004 Chr: Chr06 Coordinates: 122352391-122353770 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1131 bp · LXL04_030766|LXL04_030766|OH1004|cDNA

ATGTGGACGTTAAAAACCATGTCAACTTTCTCCACCGCCGTCTTCCTCCTCCTCCTTACTCCCTCCTCCGCTACTCCTCCACCGCCGTTCAAAAAGATCTACGCCTTCGGAGACTCTTACACAGACACCGGAAACACTAAATCCGGCACGGGACCCAGAGCCTTCACGTACGTCTCCAACCTCCCTTACGGCCGCACATTCTTCCACCGCCCAACCAACCGCTACTCCGACGGCCGTCTGGTAATCGACTTCGTGGCGGA...

CDS

Download CDS FASTA

1131 bp · LXL04_030766|LXL04_030766|OH1004|CDS

ATGTGGACGTTAAAAACCATGTCAACTTTCTCCACCGCCGTCTTCCTCCTCCTCCTTACTCCCTCCTCCGCTACTCCTCCACCGCCGTTCAAAAAGATCTACGCCTTCGGAGACTCTTACACAGACACCGGAAACACTAAATCCGGCACGGGACCCAGAGCCTTCACGTACGTCTCCAACCTCCCTTACGGCCGCACATTCTTCCACCGCCCAACCAACCGCTACTCCGACGGCCGTCTGGTAATCGACTTCGTGGCGGA...

Protein

Download Protein FASTA

376 aa · LXL04_030766|LXL04_030766|OH1004|PROTEIN

MWTLKTMSTFSTAVFLLLLTPSSATPPPPFKKIYAFGDSYTDTGNTKSGTGPRAFTYVSNLPYGRTFFHRPTNRYSDGRLVIDFVAESLSLPYLPPYLNRNADTSAGINYAVAGSTAIRHAFFVKNNLTLILTPQSLQTQLNWFNKTLKGKKCKNAVLSPAECEAVFRDALVWVGEIGANDYAYSVGSTVRSGTILRRAVRSVTEFVEVLLNKGAKYVVVQGLPTTGCLTLAMYLSPETDRDDIGCVATVNNQSYIHNTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030766`
TK1151 ID	TkA07G429590
OH-1004 ID	LXL04_030766
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030766

Location Chr06:122352391-122353770 (+)

Description Similar to At3g48460: GDSL esterase/lipase At3g48460

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48460`	GDSL esterase/lipase At3g48460.	No verified direct reference in this release
`At1g28600`	GDSL esterase/lipase At1g28600.	No verified direct reference in this release
`At1g28570`	GDSL esterase/lipase At1g28570.	No verified direct reference in this release
`At1g28590`	GDSL esterase/lipase At1g28590.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030766 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0009820 alkaloid metabolic process Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008126 acetylesterase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

GO:0033879 acetylajmaline esterase activity Molecular Function

KEGG gene cross-reference

ath:AT1G28570

ath:AT1G28590

ath:AT1G28600

ath:AT3G48460

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.562

Rank 1 · LXL04_030766 · OH-1004

Endoplasmic reticulum0.125

Rank 2 · LXL04_030766 · OH-1004

Cytoplasm0.091

Rank 3 · LXL04_030766 · OH-1004

Lysosome / Vacuole0.084

Rank 4 · LXL04_030766 · OH-1004

Cell membrane0.083

Rank 5 · LXL04_030766 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657.29Lipase_GDSL33-354 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030766	`PF00657.29`	Lipase_GDSL	33	354	1.9e-25	90.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STM6`	Arabidopsis thaliana	GDSL esterase/lipase At3g48460	55.703%	Swiss-Prot	strong database homology
`Q94F40`	Arabidopsis thaliana	GDSL esterase/lipase At1g28600	37.755%	Swiss-Prot	moderate database homology
`Q9FXJ1`	Arabidopsis thaliana	GDSL esterase/lipase At1g28570	34.545%	Swiss-Prot	moderate database homology
`Q8RXT9`	Arabidopsis thaliana	GDSL esterase/lipase At1g28590	37.228%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card