LXL04_030740 | RubberDandelionOmics

Gene overview

LXL04_030740

Reference: OH-1004 Chr: Chr06 Coordinates: 121821533-121827351 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2118 bp · LXL04_030740|LXL04_030740|OH1004|cDNA

ATGGCGAAACCTTTTCTTCTTATTCTGAAAATTTTAATGATCTTACTAGCCGTTGGGTGGGTTTCCATTTGGGTTCTGAAACCGACACAAATATGGACTAGAAAATGGAAGGTTGCTGAAGATGCTACAAAAACTACAGTTTTGGGTTCTAATGGTCTTGATTTCGTTGTTTTGTCATTGCCTATCATCCTCTCTGTGATGATTGGATTTGTGTACATGCATTTCAAACCAAAGGAACAAAGACGCAGACAAGGGAGGAG...

CDS

Download CDS FASTA

2118 bp · LXL04_030740|LXL04_030740|OH1004|CDS

ATGGCGAAACCTTTTCTTCTTATTCTGAAAATTTTAATGATCTTACTAGCCGTTGGGTGGGTTTCCATTTGGGTTCTGAAACCGACACAAATATGGACTAGAAAATGGAAGGTTGCTGAAGATGCTACAAAAACTACAGTTTTGGGTTCTAATGGTCTTGATTTCGTTGTTTTGTCATTGCCTATCATCCTCTCTGTGATGATTGGATTTGTGTACATGCATTTCAAACCAAAGGAACAAAGACGCAGACAAGGGAGGAG...

Protein

Download Protein FASTA

705 aa · LXL04_030740|LXL04_030740|OH1004|PROTEIN

MAKPFLLILKILMILLAVGWVSIWVLKPTQIWTRKWKVAEDATKTTVLGSNGLDFVVLSLPIILSVMIGFVYMHFKPKEQRRRQGRSFITALWNPIIVNGFVGVLSAMEALVILVFFIFLVWTLYIRISNDFKKMMPVKSMKLNMWQYKTFRIATRSGLLAEACLGLLLFPIMRTLSVFRLLGIQFEASIRYHIWVGTMLLTFTTLHGVGTLFIWGIKHRIQDEMWKWQKTGRIYLAGEIALIAGFVIGITSLPQVRRKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030740`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030740

Location Chr06:121821533-121827351 (+)

Description Similar to FRO8: Ferric reduction oxidase 8, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50160`	Ferric chelate reductase probably involved in iron reduction in leaf veins for transport.	Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci163
`At1g01590`	Ferric chelate reductase involved in iron reduction in roots (By similarity).	No verified direct reference in this release
`At1g23020`	Ferric chelate reductase involved in iron reduction in roots.	Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci163
`At1g01580`	Flavocytochrome that transfers electrons across the plasma membrane to reduce ferric iron chelates to form soluble ferrous iron in the rhizosphere.	A ferric-chelate reductase for iron uptake from soils.1999 · DOI: 10.1038/17800 Overexpression of the FRO2 ferric chelate reductase confers tolerance to growth on low iron and uncovers posttranscriptional control.2003 · DOI: 10.1104/pp.103.025122 Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci163 The FRO2 ferric reductase is required for glycine betaine's effect on chilling tolerance in Arabidopsis roots.2008 · DOI: 10.1111/j.1399-3054.2008.01141.x
`At5g23980`	Ferric chelate reductase.	Molecular and biochemical characterization of the Fe(III) chelate reductase gene family in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci163 Transcriptome sequencing identifies SPL7-regulated copper acquisition genes FRO4/FRO5 and the copper dependence of iron homeostasis in Arabidopsis.2012 · DOI: 10.1105/tpc.111.090431

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030740 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0033212 iron import into cell Biological Process

GO:0033214 siderophore-iron import into cell Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0000293 ferric-chelate reductase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0140618 ferric-chelate reductase (NADH) activity Molecular Function

KEGG gene cross-reference

ath:AT1G01580

ath:AT1G01590

ath:AT1G23020

ath:AT5G23980

ath:AT5G50160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.520

Rank 1 · LXL04_030740 · OH-1004

Endoplasmic reticulum0.225

Rank 2 · LXL04_030740 · OH-1004

Lysosome / Vacuole0.124

Rank 3 · LXL04_030740 · OH-1004

Cytoplasm0.076

Rank 4 · LXL04_030740 · OH-1004

Golgi apparatus0.071

Rank 5 · LXL04_030740 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01794.26Ferric_reduct158-278 aa

PF08022.19FAD_binding_8315-416 aa

PF08030.18NAD_binding_6424-678 aa

PF00175.27NAD_binding_1429-506 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030740	`PF01794.26`	Ferric_reduct	158	278	2.7e-20	73.4
LXL04_030740	`PF08022.19`	FAD_binding_8	315	416	3.2e-21	76.2
LXL04_030740	`PF08030.18`	NAD_binding_6	424	678	4e-24	86.2
LXL04_030740	`PF00175.27`	NAD_binding_1	429	506	3.9e-07	31.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY13`	Arabidopsis thaliana	Ferric reduction oxidase 8, mitochondrial	46.547%	Swiss-Prot	moderate database homology
`Q9LMM2`	Arabidopsis thaliana	Probable ferric reduction oxidase 1	31.564%	Swiss-Prot	moderate database homology
`F4I4K7`	Arabidopsis thaliana	Ferric reduction oxidase 3, mitochondrial	31.646%	Swiss-Prot	moderate database homology
`P92949`	Arabidopsis thaliana	Ferric reduction oxidase 2	31.400%	Swiss-Prot	moderate database homology
`Q8W110`	Arabidopsis thaliana	Ferric reduction oxidase 4	31.481%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card