LXL04_030648 | RubberDandelionOmics

Gene overview

LXL04_030648

Reference: OH-1004 Chr: Chr06 Coordinates: 120226015-120228160 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

768 bp · LXL04_030648|LXL04_030648|OH1004|cDNA

ATGGCGAGTAATATCGGGATGATGGATAGTGCGTATTTTGTTGGAAGGAATGAGCTTCTTTCATGGATTAATGCGAGACTTCAACTCAGTCTCTCTCGTATTGAAGAGGTTGCTTCGGGTGCTGTACAATGTCAAATGTTGGACATGACCTATCCGGGAGCCGTCCCAATGCACAAGGTTAATTTCGATGCAAGGACAGAATACGATATGATCCAGAACTACAAAGTACTTCAAGATGTATTCAACAAACTTAAAATCGA...

CDS

Download CDS FASTA

768 bp · LXL04_030648|LXL04_030648|OH1004|CDS

ATGGCGAGTAATATCGGGATGATGGATAGTGCGTATTTTGTTGGAAGGAATGAGCTTCTTTCATGGATTAATGCGAGACTTCAACTCAGTCTCTCTCGTATTGAAGAGGTTGCTTCGGGTGCTGTACAATGTCAAATGTTGGACATGACCTATCCGGGAGCCGTCCCAATGCACAAGGTTAATTTCGATGCAAGGACAGAATACGATATGATCCAGAACTACAAAGTACTTCAAGATGTATTCAACAAACTTAAAATCGA...

Protein

Download Protein FASTA

255 aa · LXL04_030648|LXL04_030648|OH1004|PROTEIN

MASNIGMMDSAYFVGRNELLSWINARLQLSLSRIEEVASGAVQCQMLDMTYPGAVPMHKVNFDARTEYDMIQNYKVLQDVFNKLKIDKHIEVNRLVKGRPLDNLEFLQWLKRYCDSVNGGIMNENYNPLERRSKISKERNVKASLKNSKSLQTNNSQNHGSGLNGTKQKPVTLVGSDSSEEIRALSNEITELKVSVDLLEKERDYYFAKLRDIEILCQGPELENIPMVMAVKKVLYAADEESALAEAQEIVSANQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030648`
TK1151 ID	TkA07G421130
OH-1004 ID	LXL04_030648
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030648

Location Chr06:120226015-120228160 (-)

Description Similar to EB1B: Microtubule-associated protein RP/EB family member 1B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62500`	Binds to the plus end of microtubules and regulates the dynamics of the microtubule cytoskeleton.	Nuclear-localized subtype of end-binding 1 protein regulates spindle organization in Arabidopsis.2010 · DOI: 10.1242/jcs.062703
`At3g47690`	Binds to the plus end of microtubules and regulates the dynamics of the microtubule cytoskeleton.	EB1 reveals mobile microtubule nucleation sites in Arabidopsis.2003 · DOI: 10.1038/ncb1057 Nuclear-localized subtype of end-binding 1 protein regulates spindle organization in Arabidopsis.2010 · DOI: 10.1242/jcs.062703
`At5g67270`	Plant-specific EB1 subtype that functions preferentially at early stages of plant mitosis by regulating spindle positioning and chromosome segregation.	Nuclear-localized subtype of end-binding 1 protein regulates spindle organization in Arabidopsis.2010 · DOI: 10.1242/jcs.062703

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030648 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000132 establishment of mitotic spindle orientation Biological Process

GO:0001578 microtubule bundle formation Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0009652 thigmotropism Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0030865 cortical cytoskeleton organization Biological Process

GO:0031110 regulation of microtubule polymerization or depolymerization Biological Process

GO:0031113 regulation of microtubule polymerization Biological Process

GO:0031115 negative regulation of microtubule polymerization Biological Process

GO:0035372 protein localization to microtubule Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0051225 spindle assembly Biological Process

KEGG gene cross-reference

ath:AT3G47690

ath:AT5G62500

ath:AT5G67270

hsa:22924

xtr:394720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.700

Rank 1 · LXL04_030648 · OH-1004

Golgi apparatus0.218

Rank 2 · LXL04_030648 · OH-1004

Nucleus0.148

Rank 3 · LXL04_030648 · OH-1004

Cell membrane0.121

Rank 4 · LXL04_030648 · OH-1004

Lysosome / Vacuole0.080

Rank 5 · LXL04_030648 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00307.37CH16-114 aa

PF03271.23EB1199-237 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030648	`PF00307.37`	CH	16	114	2.5e-10	41.2
LXL04_030648	`PF03271.23`	EB1	199	237	6.2e-16	59.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJJ5`	Arabidopsis thaliana	Microtubule-associated protein RP/EB family member 1B	70.270%	Swiss-Prot	strong database homology
`Q7XJ60`	Arabidopsis thaliana	Microtubule-associated protein RP/EB family member 1A	71.429%	Swiss-Prot	strong database homology
`Q9FGQ6`	Arabidopsis thaliana	Microtubule-associated protein RP/EB family member 1C	54.710%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card