LXL04_030628 | RubberDandelionOmics

Gene overview

LXL04_030628

Reference: OH-1004 Chr: Chr06 Coordinates: 119875241-119876415 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

732 bp · LXL04_030628|LXL04_030628|OH1004|cDNA

ATGTCTTCTTCATCAAACCCCATTAGTTTTCCTGGTTATTCCACTTCGTTTAACGAAACCCTAATCAAATCAAATAGGCCTCTTTCTCCTTCAGTTCACGCCGTCGATTTCTTCACCAAAAGATCGCAACTTTTCTCAAATCACAAGGGTTTAACTTCAAGTTCATGGAATGCCAAAACCCCTCTTCATGCACATGCGTCAATTTGCGTGAGCAAATCCATGAGATGGTGGGAAAAGACGCTTAAACCCAACATGATTGA...

CDS

Download CDS FASTA

732 bp · LXL04_030628|LXL04_030628|OH1004|CDS

ATGTCTTCTTCATCAAACCCCATTAGTTTTCCTGGTTATTCCACTTCGTTTAACGAAACCCTAATCAAATCAAATAGGCCTCTTTCTCCTTCAGTTCACGCCGTCGATTTCTTCACCAAAAGATCGCAACTTTTCTCAAATCACAAGGGTTTAACTTCAAGTTCATGGAATGCCAAAACCCCTCTTCATGCACATGCGTCAATTTGCGTGAGCAAATCCATGAGATGGTGGGAAAAGACGCTTAAACCCAACATGATTGA...

Protein

Download Protein FASTA

243 aa · LXL04_030628|LXL04_030628|OH1004|PROTEIN

MSSSSNPISFPGYSTSFNETLIKSNRPLSPSVHAVDFFTKRSQLFSNHKGLTSSSWNAKTPLHAHASICVSKSMRWWEKTLKPNMIEINSAQELVDTLSNSGDRLVIVEFYSPGCGGCKSLHPKICQLAESNLNAIFLQVNYEELKPMCHSLHIHVLPFFRFYKGSQGKICSFSCTIATIKKFKDALSKHKNDVFDLGPAKGLEESELLTLSSIGQISYNNLTKKEDLVLEEINPSMNNLLLA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030628`
TK1151 ID	TkA07G419830
OH-1004 ID	LXL04_030628
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030628

Location Chr06:119875241-119876415 (+)

Description Similar to Os03g0326500: Thioredoxin-like 1-2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08570`	Thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release
`At5g61440`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release
`At2g33270`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0326500`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release
`Os07g0684100`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030628 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0045454 cell redox homeostasis Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor Molecular Function

KEGG gene cross-reference

ath:AT1G08570

ath:AT2G33270

ath:AT5G61440

dosa:Os03g0326500

dosa:Os07g0684100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.974

Rank 1 · LXL04_030628 · OH-1004

Nucleus0.032

Rank 2 · LXL04_030628 · OH-1004

Mitochondrion0.027

Rank 3 · LXL04_030628 · OH-1004

Cytoplasm0.025

Rank 4 · LXL04_030628 · OH-1004

Cell membrane0.016

Rank 5 · LXL04_030628 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085.27Thioredoxin97-170 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030628	`PF00085.27`	Thioredoxin	97	170	4e-13	50.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64654`	Arabidopsis thaliana	Thioredoxin-like 1-1, chloroplastic	49.367%	Swiss-Prot	moderate database homology
`Q9XFI1`	Arabidopsis thaliana	Thioredoxin-like 1-2, chloroplastic	60.556%	Swiss-Prot	strong database homology
`O22779`	Arabidopsis thaliana	Thioredoxin-like 1-3, chloroplastic	47.668%	Swiss-Prot	moderate database homology
`Q10M18`	Oryza sativa subsp. japonica	Thioredoxin-like 1-2, chloroplastic	64.815%	Swiss-Prot	moderate database homology
`Q6Z4N3`	Oryza sativa subsp. japonica	Thioredoxin-like 1-1, chloroplastic	62.275%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card