LXL04_030598 | RubberDandelionOmics

Gene overview

LXL04_030598

Reference: OH-1004 Chr: Chr06 Coordinates: 119417617-119419514 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1560 bp · LXL04_030598|LXL04_030598|OH1004|cDNA

ATGGAAGAAATTGATCGAGAATCGATGAAACATGTGTGTAAATTCTGCAACAAGAGCTTCCCTTGTGGAAGATCGTTGGGGGGTCATATGAGGTCTCACGTGATCAACTCTACTGATCATCATCATCAAGCCGGGAACAGAAGCTGTTCGAGTGTTCTCGATAAACTCTGTAAAGAATGCGGAAAAGGGTTTCAATCATGGAAGGCTTTGTTTGGTCATATGAAATGTCACTCGATCAAACTCTTAAACAACAAGAACAA...

CDS

Download CDS FASTA

1560 bp · LXL04_030598|LXL04_030598|OH1004|CDS

ATGGAAGAAATTGATCGAGAATCGATGAAACATGTGTGTAAATTCTGCAACAAGAGCTTCCCTTGTGGAAGATCGTTGGGGGGTCATATGAGGTCTCACGTGATCAACTCTACTGATCATCATCATCAAGCCGGGAACAGAAGCTGTTCGAGTGTTCTCGATAAACTCTGTAAAGAATGCGGAAAAGGGTTTCAATCATGGAAGGCTTTGTTTGGTCATATGAAATGTCACTCGATCAAACTCTTAAACAACAAGAACAA...

Protein

Download Protein FASTA

519 aa · LXL04_030598|LXL04_030598|OH1004|PROTEIN

MEEIDRESMKHVCKFCNKSFPCGRSLGGHMRSHVINSTDHHHQAGNRSCSSVLDKLCKECGKGFQSWKALFGHMKCHSIKLLNNKNKNTAGLNQDTWNNNHSDNENSDAKIRQIKRSRSRSRNRPDKRFIVDSNATVITTVSSSISLNANSNQISSNNASTSMVSEIEQEQEADVAISLMMLSRDLGKLGNEFESRDHYNSSVLVNMSKIEGNDLIGNGSKVQKFANTQVGFDFLGRSESGLIKNDEFDSGFGELNDLSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030598`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030598

Location Chr06:119417617-119419514 (+)

Description Similar to ZAT9: Zinc finger protein ZAT9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g60580`	Probable transcription factor that may be involved in stress responses.	No verified direct reference in this release
`At2g45120`	Probable transcription factor that may be involved in stress responses.	No verified direct reference in this release
`At1g02030`	Probable transcription factor that may be involved in stress responses.	No verified direct reference in this release
`At4g35280`	Mediates the regulation of male germ cell division by DUO1.	An EAR-Dependent Regulatory Module Promotes Male Germ Cell Division and Sperm Fertility in Arabidopsis.2014 · DOI: 10.1105/tpc.114.124743
`At2g28200`	Probable transcription factor that may be involved in stress responses.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030598 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0048235 pollen sperm cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G02030

ath:AT2G28200

ath:AT2G45120

ath:AT3G60580

ath:AT4G35280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.981

Rank 1 · LXL04_030598 · OH-1004

Cytoplasm0.066

Rank 2 · LXL04_030598 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_030598 · OH-1004

Endoplasmic reticulum0.012

Rank 4 · LXL04_030598 · OH-1004

Plastid0.010

Rank 5 · LXL04_030598 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13912.13zf-C2H2_611-33 aa

PF13912.13zf-C2H2_657-78 aa

PF13912.13zf-C2H2_6263-287 aa

PF13912.13zf-C2H2_6346-369 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030598	`PF13912.13`	zf-C2H2_6	11	33	2.4e-37	126.8
LXL04_030598	`PF13912.13`	zf-C2H2_6	57	78	2.4e-37	126.8
LXL04_030598	`PF13912.13`	zf-C2H2_6	263	287	2.4e-37	126.8
LXL04_030598	`PF13912.13`	zf-C2H2_6	346	369	2.4e-37	126.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M202`	Arabidopsis thaliana	Zinc finger protein ZAT9	34.783%	Swiss-Prot	weak database homology
`Q9SHD0`	Arabidopsis thaliana	Zinc finger protein ZAT4	35.897%	Swiss-Prot	weak database homology
`Q39092`	Arabidopsis thaliana	Zinc finger protein ZAT1	40.559%	Swiss-Prot	weak database homology
`O65499`	Arabidopsis thaliana	Zinc finger protein ZAT3	34.014%	Swiss-Prot	weak database homology
`Q681X4`	Arabidopsis thaliana	Zinc finger protein ZAT5	32.727%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card