LXL04_030575 | RubberDandelionOmics

Gene overview

LXL04_030575

Reference: OH-1004 Chr: Chr06 Coordinates: 118880702-118882348 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1566 bp · LXL04_030575|LXL04_030575|OH1004|cDNA

ATGTCTTCCTCTGCTGCTCTCTGCATTCCCAATGACTCTAATTCGGTGCTTAGCCTCCACCTATTCCTCTGCGTTGTCGTTTTCGTCTCCGTTTTCGCTTTCTTCCTAGCTCCCGGCGGTCTCGCATGGGCTCTGTCGAAATCCAGGACGAAAACCGCCATTCCCGGACCTTCAGGATTCCCCATTTTAGGGCTTGTGTTTGCTTTCACCTCGCCATTGACTCATAAAACACTCGAGAAACTCTCCACCACCTTCAATGC...

CDS

Download CDS FASTA

1566 bp · LXL04_030575|LXL04_030575|OH1004|CDS

ATGTCTTCCTCTGCTGCTCTCTGCATTCCCAATGACTCTAATTCGGTGCTTAGCCTCCACCTATTCCTCTGCGTTGTCGTTTTCGTCTCCGTTTTCGCTTTCTTCCTAGCTCCCGGCGGTCTCGCATGGGCTCTGTCGAAATCCAGGACGAAAACCGCCATTCCCGGACCTTCAGGATTCCCCATTTTAGGGCTTGTGTTTGCTTTCACCTCGCCATTGACTCATAAAACACTCGAGAAACTCTCCACCACCTTCAATGC...

Protein

Download Protein FASTA

521 aa · LXL04_030575|LXL04_030575|OH1004|PROTEIN

MSSSAALCIPNDSNSVLSLHLFLCVVVFVSVFAFFLAPGGLAWALSKSRTKTAIPGPSGFPILGLVFAFTSPLTHKTLEKLSTTFNARSLMAFSVGLTRFVISSHPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRISATHLFSPKRISSFGIFREKIGLKMVDHVSSSMDRNGFVEVKKFLHFASLNNVMMSVFGKSYDDFDGHGDGDGVELEKLVSEGYELLGIFNWSDHFPIISWFDFQGVRK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030575`
TK1151 ID	TkA07G412030
OH-1004 ID	LXL04_030575
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030575

Location Chr06:118880702-118882348 (-)

Description Similar to CYP78A5: Cytochrome P450 78A5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13710`	Plays a role in regulating directional growth at the meristem/organ boundary.	CYP78A5 encodes a cytochrome P450 that marks the shoot apical meristem boundary in Arabidopsis.1999 · DOI: 10.1046/j.1365-313x.1999.00523.x Control of plant organ size by KLUH/CYP78A5-dependent intercellular signaling.2007 · DOI: 10.1016/j.devcel.2007.10.001 Dual effects of miR156-targeted SPL genes and CYP78A5/KLUH on plastochron length and organ size in Arabidopsis thaliana.2008 · DOI: 10.1105/tpc.108.058180 KLUH/CYP78A5-dependent growth signaling coordinates floral organ growth in Arabidopsis.2010 · DOI: 10.1016/j.cub.2010.01.039
`At2g46660`	Plays a role in seed and fruit development.	Maternal control of seed size by EOD3/CYP78A6 in Arabidopsis thaliana.2012 · DOI: 10.1111/j.1365-313x.2012.04907.x
`At3g61880`	Plays a role in seed and fruit development.	Overexpression of a gene encoding a cytochrome P450, CYP78A9, induces large and seedless fruit in arabidopsis.2000 · DOI: 10.1105/tpc.12.9.1541 Maternal control of seed size by EOD3/CYP78A6 in Arabidopsis thaliana.2012 · DOI: 10.1111/j.1365-313x.2012.04907.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030575 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0010154 fruit development Biological Process

GO:0035265 organ growth Biological Process

GO:0040009 regulation of growth rate Biological Process

GO:0046622 positive regulation of organ growth Biological Process

GO:0048316 seed development Biological Process

GO:0048437 floral organ development Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0048731 system development Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G13710

ath:AT2G46660

ath:AT3G61880

gmx:100799906

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.898

Rank 1 · LXL04_030575 · OH-1004

Plastid0.047

Rank 2 · LXL04_030575 · OH-1004

Golgi apparatus0.043

Rank 3 · LXL04_030575 · OH-1004

Cell membrane0.039

Rank 4 · LXL04_030575 · OH-1004

Cytoplasm0.036

Rank 5 · LXL04_030575 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p45055-508 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030575	`PF00067.28`	p450	55	508	3.8e-89	300.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMX7`	Arabidopsis thaliana	Cytochrome P450 78A5	63.550%	Swiss-Prot	strong database homology
`Q9ZNR0`	Arabidopsis thaliana	Cytochrome P450 78A6	50.288%	Swiss-Prot	strong database homology
`Q9SLP1`	Arabidopsis thaliana	Cytochrome P450 78A9	51.717%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card