LXL04_030571 | RubberDandelionOmics

Gene overview

LXL04_030571

Reference: OH-1004 Chr: Chr06 Coordinates: 118805966-118809866 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1320 bp · LXL04_030571|LXL04_030571|OH1004|cDNA

ATGGATAACAACAACAACTTGGAGCAGACATTGCAGGAAGGAAAGCTTTACCGATACGTGAACAATTTAATTGTTGCTCATCTTCGAGACAACAATCTCACCCAGGCTGCAAGTGCAGTTGCATCAGCTACAATGACACCACTCAACATTGAAGCTTCTCCCAACAAACTTCTCGAACTAGTTGCCAAGGGTCTTGCAGTTGAAAAAGATGAAACCCTAAGAGGAGTACTCTCATCAACATTGTTTGATTCAAACACAGT...

CDS

Download CDS FASTA

1320 bp · LXL04_030571|LXL04_030571|OH1004|CDS

ATGGATAACAACAACAACTTGGAGCAGACATTGCAGGAAGGAAAGCTTTACCGATACGTGAACAATTTAATTGTTGCTCATCTTCGAGACAACAATCTCACCCAGGCTGCAAGTGCAGTTGCATCAGCTACAATGACACCACTCAACATTGAAGCTTCTCCCAACAAACTTCTCGAACTAGTTGCCAAGGGTCTTGCAGTTGAAAAAGATGAAACCCTAAGAGGAGTACTCTCATCAACATTGTTTGATTCAAACACAGT...

Protein

Download Protein FASTA

439 aa · LXL04_030571|LXL04_030571|OH1004|PROTEIN

MDNNNNLEQTLQEGKLYRYVNNLIVAHLRDNNLTQAASAVASATMTPLNIEASPNKLLELVAKGLAVEKDETLRGVLSSTLFDSNTVLPSSYGLIPPPRAVSVDFSAAHDTKGSSKSFPKHETRHVSEHKNVARCARFSPDGRFLASGSADTSIKLFEVGKIKQMLLPEGRDGPVRPVVRTFYDHLQPINDLDFHPHNTILISGAKDHTIKFFDFSKTVAKRAFRVIQDTHNVRSVSFHPSGDFVLAGTDHHVPHLYDIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030571`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030571

Location Chr06:118805966-118809866 (+)

Description Similar to CSTF50: Cleavage stimulation factor subunit 50

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60940`	One of the multiple factors required for polyadenylation and 3'-end cleavage of pre-mRNAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030571 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0031124 mRNA 3'-end processing Biological Process

GO:0031440 regulation of mRNA 3'-end processing Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005848 mRNA cleavage stimulating factor complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G60940

hsa:1477

mmu:67337

pon:100174553

rno:311670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.529

Rank 1 · LXL04_030571 · OH-1004

Cytoplasm0.459

Rank 2 · LXL04_030571 · OH-1004

Lysosome / Vacuole0.076

Rank 3 · LXL04_030571 · OH-1004

Cell membrane0.064

Rank 4 · LXL04_030571 · OH-1004

Golgi apparatus0.037

Rank 5 · LXL04_030571 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29040.1LisH_CTF506-75 aa

PF25172.2Beta-prop_WDR3_2nd105-304 aa

PF24782.3WD40_MABP1-WDR62_2nd117-173 aa

PF24807.2WD40_CDC20-Fz121-217 aa

PF25174.2Beta-prop_THOC3122-176 aa

PF23414.2Beta-prop_EML_2123-161 aa

PF25391.2WD40_Gbeta123-289 aa

PF00400.39WD40124-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030571	`PF29040.1`	LisH_CTF50	6	75	8.3e-40	135.3
LXL04_030571	`PF25172.2`	Beta-prop_WDR3_2nd	105	304	2.8e-28	99.7
LXL04_030571	`PF24782.3`	WD40_MABP1-WDR62_2nd	117	173	3.7e-15	56.4
LXL04_030571	`PF24807.2`	WD40_CDC20-Fz	121	217	4.4e-26	92.6
LXL04_030571	`PF25174.2`	Beta-prop_THOC3	122	176	1.7e-39	136.2
LXL04_030571	`PF23414.2`	Beta-prop_EML_2	123	161	5.4e-25	89.0
LXL04_030571	`PF25391.2`	WD40_Gbeta	123	289	3.6e-17	63.1
LXL04_030571	`PF00400.39`	WD40	124	157	3.9e-38	129.0
LXL04_030571	`PF23409.2`	Beta-prop_EML	124	351	1.9e-10	41.4
LXL04_030571	`PF23381.2`	Beta-prop_IFT122_1st	125	250	5.4e-37	128.3
LXL04_030571	`PF25173.2`	Beta-prop_WDR3_1st	125	258	6.7e-34	117.9
LXL04_030571	`PF20426.5`	NBCH_WD40	125	312	4.5e-09	36.3
LXL04_030571	`PF25175.2`	Beta-prop_WDR5	126	436	7.4e-49	167.3
LXL04_030571	`PF24814.2`	WD40_Prp19	126	175	2.5e-33	116.1
LXL04_030571	`PF24817.2`	WD40_WDHD1_1st	126	314	7.5e-30	104.8
LXL04_030571	`PF24105.2`	Beta-prop_CAF1B_HIR1	126	267	1.8e-15	57.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L4J2`	Arabidopsis thaliana	Cleavage stimulation factor subunit 50	67.123%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card