LXL04_030558 | RubberDandelionOmics

Gene overview

LXL04_030558

Reference: OH-1004 Chr: Chr06 Coordinates: 118493986-118504831 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3491 bp · LXL04_030558|LXL04_030558|OH1004|cDNA

ATGGCTTCATCAAATGAAATATTGGAATCCAATCTCGCAACAACAAAGAATCATGAACAGAACGGCGAATTAAAGGGCAAATTGGATGATTATCCAACTGGAGAATTTGAATTCAAAAAATCAGGTACGTGGAAGAGCTTAATGGTGAAGCTACGCCTGCTAACTGCTTATCCATGGGAACGTGTTCGTCATGGTAGTGTTTTAAACATCAAATTACGTGGCAAGATATCTGATCAGGTGAAGAGTCGTTTCTCATCAGG...

CDS

Download CDS FASTA

3465 bp · LXL04_030558|LXL04_030558|OH1004|CDS

ATGGCTTCATCAAATGAAATATTGGAATCCAATCTCGCAACAACAAAGAATCATGAACAGAACGGCGAATTAAAGGGCAAATTGGATGATTATCCAACTGGAGAATTTGAATTCAAAAAATCAGGTACGTGGAAGAGCTTAATGGTGAAGCTACGCCTGCTAACTGCTTATCCATGGGAACGTGTTCGTCATGGTAGTGTTTTAAACATCAAATTACGTGGCAAGATATCTGATCAGGTGAAGAGTCGTTTCTCATCAGG...

Protein

Download Protein FASTA

1154 aa · LXL04_030558|LXL04_030558|OH1004|PROTEIN

MASSNEILESNLATTKNHEQNGELKGKLDDYPTGEFEFKKSGTWKSLMVKLRLLTAYPWERVRHGSVLNIKLRGKISDQVKSRFSSGLSLPQICENLIKAAYDPRISGVYLHIETLSCGWGKIEEVRRHILDFRKSGKFIIAYAPVWHEKGYYLGCACEELYAPPSAYFSLYGFKAQASFIGGVLEKVGVEPQIERIGKYKSMGDRITRKNISEEDREVLTTLVDNVYENWVNTVSQSKGKKKEDIESFINEGVYQVEKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030558`
TK1151 ID	TkA07G410910
OH-1004 ID	LXL04_030558
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	90.800
Protein coverage (%)	TK1151 99.835 / OH-1004 51.733 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030558

Location Chr06:118493986-118504831 (-)

Description Similar to SPPA: Serine protease SPPA, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73990`	Serine protease that may be involved in the light-dependent degradation of antenna and photosystem II in chloroplasts.	Identification and characterization of SppA, a novel light-inducible chloroplast protease complex associated with thylakoid membranes.2001 · DOI: 10.1074/jbc.m100506200 Loss of chloroplast protease SPPA function alters high light acclimation processes in Arabidopsis thaliana L. (Heynh.).2009 · DOI: 10.1093/jxb/erp051

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030558 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006465 signal peptide processing Biological Process

GO:0009642 response to light intensity Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0004252 serine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G73990

hin:HI_1541

syn:sll1703

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.560

Rank 1 · LXL04_030558 · OH-1004

Lysosome / Vacuole0.148

Rank 2 · LXL04_030558 · OH-1004

Endoplasmic reticulum0.136

Rank 3 · LXL04_030558 · OH-1004

Extracellular0.110

Rank 4 · LXL04_030558 · OH-1004

Mitochondrion0.100

Rank 5 · LXL04_030558 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01343.24Peptidase_S49133-284 aa

PF01343.24Peptidase_S49385-506 aa

PF01343.24Peptidase_S49681-831 aa

PF01343.24Peptidase_S49933-1081 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030558	`PF01343.24`	Peptidase_S49	133	284	5.7e-118	390.8
LXL04_030558	`PF01343.24`	Peptidase_S49	385	506	5.7e-118	390.8
LXL04_030558	`PF01343.24`	Peptidase_S49	681	831	5.7e-118	390.8
LXL04_030558	`PF01343.24`	Peptidase_S49	933	1081	5.7e-118	390.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9C0`	Arabidopsis thaliana	Serine protease SPPA, chloroplastic	66.667%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card