LXL04_030547 | RubberDandelionOmics

Gene overview

LXL04_030547

Reference: OH-1004 Chr: Chr06 Coordinates: 118377736-118378983 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

759 bp · LXL04_030547|LXL04_030547|OH1004|cDNA

ATGACTTCTCTTCTTCTTTCAAACCCGATTGTCTCATCTCCTTTCCTCGGCAAGAAACTTTCGGTTACCAATAATTCAAGGAAATCGACACTGTCCGCTCTGGTGGTTAGGAGCCCTAGATGTGCAGCTGCTGATGCAACATTTGGAGGCAACCCTCCCAAATACTCTCGCAGTAATATCTGGGATCCCTACAAGCGTCTAGGCATAACAACCGATGCTTCTGAAGAAGAAGTCTGGAGTTCACGCAACTTTCTTCTAGA...

CDS

Download CDS FASTA

759 bp · LXL04_030547|LXL04_030547|OH1004|CDS

ATGACTTCTCTTCTTCTTTCAAACCCGATTGTCTCATCTCCTTTCCTCGGCAAGAAACTTTCGGTTACCAATAATTCAAGGAAATCGACACTGTCCGCTCTGGTGGTTAGGAGCCCTAGATGTGCAGCTGCTGATGCAACATTTGGAGGCAACCCTCCCAAATACTCTCGCAGTAATATCTGGGATCCCTACAAGCGTCTAGGCATAACAACCGATGCTTCTGAAGAAGAAGTCTGGAGTTCACGCAACTTTCTTCTAGA...

Protein

Download Protein FASTA

252 aa · LXL04_030547|LXL04_030547|OH1004|PROTEIN

MTSLLLSNPIVSSPFLGKKLSVTNNSRKSTLSALVVRSPRCAAADATFGGNPPKYSRSNIWDPYKRLGITTDASEEEVWSSRNFLLDQYGAHERSAESIEAAFEKILMTSFQNRKKTKINLKTKLKKKVEESPPWVQSLLAFVELPPTIIILRRLFLFSFMAFWSVMNSADGGPAFQVALSLFACIYFLNDKSKSIGRACLIGFGSLVVGWICGSCVVPMIPAAILQPTWTLELLTSLVVYIFLFLGCTFLK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030547`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030547

Location Chr06:118377736-118378983 (+)

Description Similar to CPP1: Protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23040`	Essential protein required during embryogenesis.	Plastidic protein Cdf1 is essential in Arabidopsis embryogenesis.2014 · DOI: 10.1007/s00425-013-1966-1 Cell growth defect factor1/chaperone-like protein of POR1 plays a role in stabilization of light-dependent protochlorophyllide oxidoreductase in Nicotiana benthamiana and Arabidopsis.2013 · DOI: 10.1105/tpc.113.111096

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030547 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009704 de-etiolation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:1904216 positive regulation of protein import into chloroplast stroma Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

KEGG gene cross-reference

ath:AT5G23040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.973

Rank 1 · LXL04_030547 · OH-1004

Mitochondrion0.026

Rank 2 · LXL04_030547 · OH-1004

Nucleus0.021

Rank 3 · LXL04_030547 · OH-1004

Cytoplasm0.015

Rank 4 · LXL04_030547 · OH-1004

Cell membrane0.010

Rank 5 · LXL04_030547 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11833.14CPP1-like72-251 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030547	`PF11833.14`	CPP1-like	72	251	8.1e-58	196.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN50`	Arabidopsis thaliana	Protein CHAPERONE-LIKE PROTEIN OF POR1, chloroplastic	65.966%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card