Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1902 bp · LXL04_030544|LXL04_030544|OH1004|cDNA
ATGGACCCTCGCCGACCCTCCCGGGTGATCGATCCCAAAGTCCGGAAGGTCGGCTTCTTCACCCCTGGTCCACCCCCAGACCGCACCCAATCAGGTCCGGCCGCCACCCCTCCCTCTCAGTCTCCTATCTCCAATACCCTTTCTCCCATCATGATTCCACCCGCTCGCCATGCGTCAGACAACTTGTCTCGGGCAGTTGGCATGCCCGTTCCGGCAGGTTCTCAATTGCATGGTCACCCGCCGGTCGATAGCTTGCAAGT...
1902 bp · LXL04_030544|LXL04_030544|OH1004|CDS
ATGGACCCTCGCCGACCCTCCCGGGTGATCGATCCCAAAGTCCGGAAGGTCGGCTTCTTCACCCCTGGTCCACCCCCAGACCGCACCCAATCAGGTCCGGCCGCCACCCCTCCCTCTCAGTCTCCTATCTCCAATACCCTTTCTCCCATCATGATTCCACCCGCTCGCCATGCGTCAGACAACTTGTCTCGGGCAGTTGGCATGCCCGTTCCGGCAGGTTCTCAATTGCATGGTCACCCGCCGGTCGATAGCTTGCAAGT...
Protein
Download Protein FASTA633 aa · LXL04_030544|LXL04_030544|OH1004|PROTEIN
MDPRRPSRVIDPKVRKVGFFTPGPPPDRTQSGPAATPPSQSPISNTLSPIMIPPARHASDNLSRAVGMPVPAGSQLHGHPPVDSLQVGSYTLSDSVLSPSPTRSPSSRVGLDGDFSEDSVNWMKRSNSGRYTPVLPTGGPDLTQSIEASIDESSGDHIAELQKNPKPLKAKTTKAERRALQEAQRAAKATAKGEGNKSVATSATSAPAQTSKPARHPSQKKEPPPLVSSTPILEKKGTEKAPEKDRKKEVPPPRMQFDDK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_030544 |
|---|---|
| TK1151 ID | TkA07G410520 |
| OH-1004 ID | LXL04_030544 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 98.900 |
| Protein coverage (%) | TK1151 98.670 / OH-1004 58.610Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_030544 |
|---|---|
| Location | Chr06:118358155-118361034 (+) |
| Description | Similar to EIF2B4: Translation initiation factor eIF-2B subunit delta |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002183 cytoplasmic translational initiation Biological Process GO:0006413 translational initiation Biological Process GO:0006417 regulation of translation Biological Process GO:0009408 response to heat Biological Process GO:0009749 response to glucose Biological Process GO:0043434 response to peptide hormone Biological Process GO:0045948 positive regulation of translational initiation Biological Process GO:0050852 T cell receptor signaling pathway Biological Process GO:1905098 negative regulation of guanyl-nucleotide exchange factor activity Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005851 eukaryotic translation initiation factor 2B complex Cellular Component |
| KEGG gene cross-reference | bta:521926 hsa:8890 mmu:13667 ocu:100009560 rno:117019 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01008.24IF-2B328-616 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_030544 | PF01008.24 | IF-2B | 328 | 616 | 2.6e-79 | 267.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.