LXL04_030495 | RubberDandelionOmics

Gene overview

LXL04_030495

Reference: OH-1004 Chr: Chr06 Coordinates: 117157952-117164960 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1197 bp · LXL04_030495|LXL04_030495|OH1004|cDNA

ATGGAGTCTGCAAattttcaccaacaacatcaCGATCATCAACCTCTTCCAGACTCTTCTTGCTATGGACTTTCATGGTCCCAAAATCCCATCTTGAACAACGGTACAAATTCTCACAACTCTAGCAGTACTTCTATGGTACATGAACTGGGATTACCATGGAATaccaccaacaacaacaacaatgtcACAAACAATAATCCGATCGAAAACTTCATGACCCATGAATTGACGCATCTCACAAGAACTACAAAAGATGA...

CDS

Download CDS FASTA

1197 bp · LXL04_030495|LXL04_030495|OH1004|CDS

ATGGAGTCTGCAAATTTTCACCAACAACATCACGATCATCAACCTCTTCCAGACTCTTCTTGCTATGGACTTTCATGGTCCCAAAATCCCATCTTGAACAACGGTACAAATTCTCACAACTCTAGCAGTACTTCTATGGTACATGAACTGGGATTACCATGGAATACCACCAACAACAACAACAATGTCACAAACAATAATCCGATCGAAAACTTCATGACCCATGAATTGACGCATCTCACAAGAACTACAAAAGATGA...

Protein

Download Protein FASTA

398 aa · LXL04_030495|LXL04_030495|OH1004|PROTEIN

MESANFHQQHHDHQPLPDSSCYGLSWSQNPILNNGTNSHNSSSTSMVHELGLPWNTTNNNNNVTNNNPIENFMTHELTHLTRTTKDEFSVSESYPKFTDMINSSPTSSIEDMQLKPSPNYTNNHELLFRTFSNGCQIKGGHGQIMDQFTDDDSNNHYQNGSRSRGSFSQIFPTINISNLNQSPANSFDMNLPALDLFGSPRFNGSFSHNPSSFNPHHQTGSFFKDTCLSYGLDQMHQLPHRPAICPSKISSGTSCTEAKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030495`
TK1151 ID	TkA07G407850
OH-1004 ID	LXL04_030495
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030495

Location Chr06:117157952-117164960 (-)

Description Similar to BHLH110: Transcription factor bHLH110

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g27660`	Transcription factor bHLH110.	No verified direct reference in this release
`At4g29100`	Transcription factor bHLH68.	No verified direct reference in this release
`At2g20100`	Transcription factor bHLH133.	No verified direct reference in this release
`At3g19500`	Transcription factor bHLH113.	No verified direct reference in this release
`At3g20640`	Transcription factor bHLH123.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030495 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0005634 nucleus Cellular Component

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G27660

ath:AT2G20100

ath:AT3G19500

ath:AT3G20640

ath:AT4G29100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.983

Rank 1 · LXL04_030495 · OH-1004

Cytoplasm0.071

Rank 2 · LXL04_030495 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_030495 · OH-1004

Endoplasmic reticulum0.020

Rank 4 · LXL04_030495 · OH-1004

Plastid0.011

Rank 5 · LXL04_030495 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27761.2VUP_C368-385 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030495	`PF27761.2`	VUP_C	368	385	1e-07	31.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFZ3`	Arabidopsis thaliana	Transcription factor bHLH110	41.945%	Swiss-Prot	moderate database homology
`Q8S3D1`	Arabidopsis thaliana	Transcription factor bHLH68	46.000%	Swiss-Prot	weak database homology
`Q7XHI5`	Arabidopsis thaliana	Transcription factor bHLH133	42.953%	Swiss-Prot	weak database homology
`Q9LT67`	Arabidopsis thaliana	Transcription factor bHLH113	40.816%	Swiss-Prot	weak database homology
`Q8GXT3`	Arabidopsis thaliana	Transcription factor bHLH123	55.652%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card