LXL04_030477 | RubberDandelionOmics

Gene overview

LXL04_030477

Reference: OH-1004 Chr: Chr06 Coordinates: 116795148-116798716 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1593 bp · LXL04_030477|LXL04_030477|OH1004|cDNA

ATGCTCAATGTCACGTCGAAACTCGAAACATCCCTCCCTCTCACCCAACCACAACTCGACACGTCAGCAAAGCAACAGTCACAAGTCAAATCACAAAGAGAAGAACCGATCTACAGAGAGGAGCAAATCGCAATGAGTTTCAGGGATGATAATGAAGATGGGAAGGATCTCCGAAAACCATTTCTTCATACCGGAAGTTGGTACCGTATGGGTTCGAGGCAGTCCAGTATGATGACATCTTCTCAAATGATCAGAGACCG...

CDS

Download CDS FASTA

1593 bp · LXL04_030477|LXL04_030477|OH1004|CDS

ATGCTCAATGTCACGTCGAAACTCGAAACATCCCTCCCTCTCACCCAACCACAACTCGACACGTCAGCAAAGCAACAGTCACAAGTCAAATCACAAAGAGAAGAACCGATCTACAGAGAGGAGCAAATCGCAATGAGTTTCAGGGATGATAATGAAGATGGGAAGGATCTCCGAAAACCATTTCTTCATACCGGAAGTTGGTACCGTATGGGTTCGAGGCAGTCCAGTATGATGACATCTTCTCAAATGATCAGAGACCG...

Protein

Download Protein FASTA

530 aa · LXL04_030477|LXL04_030477|OH1004|PROTEIN

MLNVTSKLETSLPLTQPQLDTSAKQQSQVKSQREEPIYREEQIAMSFRDDNEDGKDLRKPFLHTGSWYRMGSRQSSMMTSSQMIRDRSVSVLACVLIVALGPIQFGFTGGYSSPTQTEISRDLKLTVSEFSLFGSLSNVGAMVGAVASGQIAEYIGRKGSLMIAAIPNILGWLAISFAKDSSFLYMGRLLEGFGVGIISYTVPVYIAEIAPQNMRGGLGSVNQLSVTIGIMLSYLLGLFVNWRVLAVLGTLPCLILIPGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030477`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030477

Location Chr06:116795148-116798716 (-)

Description Similar to At1g75220: Sugar transporter ERD6-like 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75220`	Sugar transporter.	No verified direct reference in this release
`At1g19450`	Sugar transporter.	No verified direct reference in this release
`At5g18840`	Sugar transporter.	No verified direct reference in this release
`At2g48020`	Sugar transporter.	No verified direct reference in this release
`At1g54730`	Sugar transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030477 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006829 zinc ion transport Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0042593 glucose homeostasis Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G19450

ath:AT1G54730

ath:AT1G75220

ath:AT2G48020

ath:AT5G18840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.425

Rank 1 · LXL04_030477 · OH-1004

Lysosome / Vacuole0.274

Rank 2 · LXL04_030477 · OH-1004

Cytoplasm0.138

Rank 3 · LXL04_030477 · OH-1004

Endoplasmic reticulum0.091

Rank 4 · LXL04_030477 · OH-1004

Golgi apparatus0.078

Rank 5 · LXL04_030477 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00083.31Sugar_tr95-529 aa

PF07690.22MFS_1106-474 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030477	`PF00083.31`	Sugar_tr	95	529	1.1e-94	318.7
LXL04_030477	`PF07690.22`	MFS_1	106	474	1.9e-25	90.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FRL3`	Arabidopsis thaliana	Sugar transporter ERD6-like 6	79.261%	Swiss-Prot	strong database homology
`Q93YP9`	Arabidopsis thaliana	Sugar transporter ERD6-like 4	77.459%	Swiss-Prot	strong database homology
`Q8LBI9`	Arabidopsis thaliana	Sugar transporter ERD6-like 16	43.606%	Swiss-Prot	moderate database homology
`P93051`	Arabidopsis thaliana	Sugar transporter ERD6-like 7	45.270%	Swiss-Prot	moderate database homology
`Q3ECP7`	Arabidopsis thaliana	Sugar transporter ERD6-like 5	45.012%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card