LXL04_030166 | RubberDandelionOmics

Gene overview

LXL04_030166

Reference: OH-1004 Chr: Chr06 Coordinates: 109850930-109851265 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

336 bp · LXL04_030166|LXL04_030166|OH1004|cDNA

ATGAAGTTGAAAGATGTGGGGGTTATGGTATACATCTCCTTAATGAGCACTTCAATGGTCTTCTGTCATAACAACTTGTTGTTTTCCGACCAAAGATCCCCCAATCGTAAACCATTGTATTTTGATAGTCCCGTTCACGTGAGCGGCGTCGGAAGGAGGGTAATCAGACGATTGATCCCAAACGCGAAGAAAAAACACAAGAACAAACGGATCTGGTGGAAGAAATTCTTCTTCGACGAAGATGCAAATTGGTTCGGCTT...

CDS

Download CDS FASTA

336 bp · LXL04_030166|LXL04_030166|OH1004|CDS

ATGAAGTTGAAAGATGTGGGGGTTATGGTATACATCTCCTTAATGAGCACTTCAATGGTCTTCTGTCATAACAACTTGTTGTTTTCCGACCAAAGATCCCCCAATCGTAAACCATTGTATTTTGATAGTCCCGTTCACGTGAGCGGCGTCGGAAGGAGGGTAATCAGACGATTGATCCCAAACGCGAAGAAAAAACACAAGAACAAACGGATCTGGTGGAAGAAATTCTTCTTCGACGAAGATGCAAATTGGTTCGGCTT...

Protein

Download Protein FASTA

111 aa · LXL04_030166|LXL04_030166|OH1004|PROTEIN

MKLKDVGVMVYISLMSTSMVFCHNNLLFSDQRSPNRKPLYFDSPVHVSGVGRRVIRRLIPNAKKKHKNKRIWWKKFFFDEDANWFGLKEDEMLEAEEEFGKDSSDDEEVLS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030166`
TK1151 ID	TkA04G325050
OH-1004 ID	LXL04_030166
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 57.812 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030166

Location Chr06:109850930-109851265 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31040`	Promotes K(+)/H(+) antiport activity supporting K(+) efflux to control H(+) homeostasis in chloroplasts.	DAY-LENGTH-DEPENDENT DELAYED-GREENING1, the Arabidopsis Homolog of the Cyanobacterial H+-Extrusion Protein, Is Essential for Chloroplast pH Regulation and Optimization of Non-Photochemical Quenching.2019 · DOI: 10.1093/pcp/pcz203 Arabidopsis mutants lacking DLDG1 and non-photochemical quenching-related proteins reveal the regulatory role of DLDG1 in chloroplast pH homeostasis.2023 · DOI: 10.1002/1873-3468.14687

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030166 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010196 nonphotochemical quenching Biological Process

GO:0034755 iron ion transmembrane transport Biological Process

GO:0051453 regulation of intracellular pH Biological Process

GO:0071805 potassium ion transmembrane transport Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0015093 ferrous iron transmembrane transporter activity Molecular Function

GO:0015386 potassium:proton antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G31040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.646

Rank 1 · LXL04_030166 · OH-1004

Mitochondrion0.141

Rank 2 · LXL04_030166 · OH-1004

Nucleus0.136

Rank 3 · LXL04_030166 · OH-1004

Cytoplasm0.073

Rank 4 · LXL04_030166 · OH-1004

Cell membrane0.038

Rank 5 · LXL04_030166 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXP7`	Arabidopsis thaliana	Protein DAY-LENGTH-DEPENDENT DELAYED-GREENING 1, chloroplastic	37.500%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card