LXL04_030142 | RubberDandelionOmics

Gene overview

LXL04_030142

Reference: OH-1004 Chr: Chr06 Coordinates: 109219061-109219456 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

396 bp · LXL04_030142|LXL04_030142|OH1004|cDNA

ATGAACAACAAAAGAcgaccatcatcatcatcctcaACAAAATGCAAGAAACACCCAAAACATGAGCAATCTCCCGGAGTCTGCTCGTTGTGTTTAAGAGAAAGATTAAGGAAGATTTCAAAGTCTTCATCACGGGTTACCACATACGCATCTtcttcttcatgttcttcatcTTCGATCTCTTCGGTATCTTCGGTTTCTTCTTTATCAAACACAGAATCTCCCATGCATGATTATCGAAAAGGGCATGTTTCTTTCCT...

CDS

Download CDS FASTA

396 bp · LXL04_030142|LXL04_030142|OH1004|CDS

ATGAACAACAAAAGACGACCATCATCATCATCCTCAACAAAATGCAAGAAACACCCAAAACATGAGCAATCTCCCGGAGTCTGCTCGTTGTGTTTAAGAGAAAGATTAAGGAAGATTTCAAAGTCTTCATCACGGGTTACCACATACGCATCTTCTTCTTCATGTTCTTCATCTTCGATCTCTTCGGTATCTTCGGTTTCTTCTTTATCAAACACAGAATCTCCCATGCATGATTATCGAAAAGGGCATGTTTCTTTCCT...

Protein

Download Protein FASTA

131 aa · LXL04_030142|LXL04_030142|OH1004|PROTEIN

MNNKRRPSSSSSTKCKKHPKHEQSPGVCSLCLRERLRKISKSSSRVTTYASSSSCSSSSISSVSSVSSLSNTESPMHDYRKGHVSFLKSKLKKSKSMAFVGRRIVEDDGKKKSGFWSKLMHSRTMREKLTT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030142`
TK1151 ID	TkA07G381490
OH-1004 ID	LXL04_030142
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030142

Location Chr06:109219061-109219456 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g35210`	Involved in the acclimation to abiotic stress tolerance.	No verified direct reference in this release
`At1g22470`	Involved in the acclimation to abiotic stress tolerance.	No verified direct reference in this release
`At1g72240`	Involved in the acclimation to abiotic stress tolerance.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030142 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT1G22470

ath:AT1G35210

ath:AT1G72240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.485

Rank 1 · LXL04_030142 · OH-1004

Cytoplasm0.399

Rank 2 · LXL04_030142 · OH-1004

Cell membrane0.314

Rank 3 · LXL04_030142 · OH-1004

Endoplasmic reticulum0.053

Rank 4 · LXL04_030142 · OH-1004

Plastid0.019

Rank 5 · LXL04_030142 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05340.18DUF7407-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030142	`PF05340.18`	DUF740	7	98	4.4e-07	29.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GY45`	Arabidopsis thaliana	Protein SALT UP-REGULATED GENE C	57.143%	Swiss-Prot	weak database homology
`Q8L443`	Arabidopsis thaliana	Protein SALT UP-REGULATED GENE B	76.923%	Swiss-Prot	weak database homology
`Q9C7T1`	Arabidopsis thaliana	Protein SALT UP-REGULATED GENE D	76.923%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card