LXL04_030050 | RubberDandelionOmics

Gene overview

LXL04_030050

Reference: OH-1004 Chr: Chr06 Coordinates: 106413298-106414062 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

690 bp · LXL04_030050|LXL04_030050|OH1004|cDNA

ATGGTGTGGACAATGTCCGAGATTATTAAACCAAGAGTTATGCAAAAGCTACAAGAAGAAATCAGAAGACGCGTCAAAGGAAAAGCCAGTGTTGAGGAATCAGATATCGCACAAATGCCATATGTAAAACTGGTGGTAAAGGAGGCGTTAAGATTACATTCGACTGTTCCATTTCTGCTTACAAGAGAATGCGTAAAGCAGTGTCAGATTGGTGGGTACGACATCTACCTTGGGACACGAGTGTTGATCAATGCATGGGG...

CDS

Download CDS FASTA

690 bp · LXL04_030050|LXL04_030050|OH1004|CDS

ATGGTGTGGACAATGTCCGAGATTATTAAACCAAGAGTTATGCAAAAGCTACAAGAAGAAATCAGAAGACGCGTCAAAGGAAAAGCCAGTGTTGAGGAATCAGATATCGCACAAATGCCATATGTAAAACTGGTGGTAAAGGAGGCGTTAAGATTACATTCGACTGTTCCATTTCTGCTTACAAGAGAATGCGTAAAGCAGTGTCAGATTGGTGGGTACGACATCTACCTTGGGACACGAGTGTTGATCAATGCATGGGG...

Protein

Download Protein FASTA

229 aa · LXL04_030050|LXL04_030050|OH1004|PROTEIN

MVWTMSEIIKPRVMQKLQEEIRRRVKGKASVEESDIAQMPYVKLVVKEALRLHSTVPFLLTRECVKQCQIGGYDIYLGTRVLINAWGIGRDPKVWTETAFVFNPERLENAELDRSEMIPFGGVRRACPASSVATQVVEFTIANLFYFFDWQLSSGMKNQELDMEEVGSLIVVRKTPLCLRVIAFVQHGVVDYLPLWIICQRYVGLEKEDAIVDYLPEICGPRERGWSIP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030050`
TK1151 ID	TkA07G372950
OH-1004 ID	LXL04_030050
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	94.000
Protein coverage (%)	TK1151 100.000 / OH-1004 83.406 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030050

Location Chr06:106413298-106414062 (+)

Description Similar to CYP71DD6: Eupatolide synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g26300`	Cytochrome P450 71B34.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030050 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016114 terpenoid biosynthetic process Biological Process

GO:0051762 sesquiterpene biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen Molecular Function

GO:0020037 heme binding Molecular Function

GO:0102626 parthenolide synthase activity Molecular Function

GO:0106244 eupatolide synthase activity Molecular Function

KEGG gene cross-reference

ath:AT3G26300

gmx:606548

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.380

Rank 1 · LXL04_030050 · OH-1004

Cytoplasm0.202

Rank 2 · LXL04_030050 · OH-1004

Peroxisome0.199

Rank 3 · LXL04_030050 · OH-1004

Plastid0.063

Rank 4 · LXL04_030050 · OH-1004

Nucleus0.059

Rank 5 · LXL04_030050 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p4508-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030050	`PF00067.28`	p450	8	167	2e-39	136.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIP6`	Arabidopsis thaliana	Cytochrome P450 71B34	44.503%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card