LXL04_030026 | RubberDandelionOmics

Gene overview

LXL04_030026

Reference: OH-1004 Chr: Chr06 Coordinates: 105994773-105998859 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1788 bp · LXL04_030026|LXL04_030026|OH1004|cDNA

TTTCCTTTTGCTCACTCACCAAATAAAGACCAGTAAACGCTTGGACCCGAAAGAAAAACCCCAAAGTCATCCCTTTGGGCCTTTGGGGTAACAAATCTTCTCCTACACGCCTCTTCTAAATCTCTCAATAACCTTTCCGATCAAATCCCACTTCAATCAATCCTAACAGAGCTTCAATTAACCTCTAACATAGCTTCAATTGATCGAAAACAAGCGCTTTCTGCCCCCAATTTGATGGGTTCTGACTTGATTGAAGCAGT...

CDS

Download CDS FASTA

1557 bp · LXL04_030026|LXL04_030026|OH1004|CDS

TTGATGGGTTCTGACTTGATTGAAGCAGTGACGGTATCAAAGTCAAAGTCGTCGCCCTCCGCCGGAAAGTGCTTTCCACCTGGTTTCAGATTCCATCCGACTGATGAAGAATTGGTTCTCTATTATCTAAAGAGGAAGATCTGCGGTCGATCGCTCAAGCTCAACATCATCGGCGAAGTTGATGTTTACAAGTGGGACCCGGAAGAGTTACCTGGGAAATCAAAATTAAAATCAGGCGACCGACAATGGTTCTTTTTCAG...

Protein

Download Protein FASTA

518 aa · LXL04_030026|LXL04_030026|OH1004|PROTEIN

MMGSDLIEAVTVSKSKSSPSAGKCFPPGFRFHPTDEELVLYYLKRKICGRSLKLNIIGEVDVYKWDPEELPGKSKLKSGDRQWFFFSPRDRKYPNGGRSSRATMNGYWKATGKDRIIKRKSTPVGIKKTLVYYQGRAPSGTRTDWVMHEYTMDEDELKRCHVTQEHYVLYKIFKKSGPGPKNGEQYGAPFVEEEWSDDDCLDLDSFLVNKRNPVPIPIPIPENDLKSVREEEENVFTNDIVEFLNKIIDEPEILPPLPQI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030026`
TK1151 ID	TkA07G371340
OH-1004 ID	LXL04_030026
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.400
Protein coverage (%)	TK1151 82.168 / OH-1004 90.927 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030026

Location Chr06:105994773-105998859 (+)

Description Similar to NAC017: NAC domain-containing protein 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34190`	Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP).	A membrane-bound NAC transcription factor, ANAC017, mediates mitochondrial retrograde signaling in Arabidopsis.2013 · DOI: 10.1105/tpc.113.113985
`At1g34180`	Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity).	Mutation of the Arabidopsis NAC016 transcription factor delays leaf senescence.2013 · DOI: 10.1093/pcp/pct113
`At5g04410`	Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity).	No verified direct reference in this release
`At1g32870`	Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0119966`	Transcription factor that functions as a regulator of the jasmonate (JA) signaling pathway.	Disruption of a novel gene for a NAC-domain protein in rice confers resistance to Rice dwarf virus.2009 · DOI: 10.1111/j.1365-313x.2008.03712.x The NAC transcription factor RIM1 of rice is a new regulator of jasmonate signaling.2010 · DOI: 10.1111/j.1365-313x.2009.04107.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030026 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009962 regulation of flavonoid biosynthetic process Biological Process

GO:0010114 response to red light Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010224 response to UV-B Biological Process

GO:0031930 mitochondria-nucleus signaling pathway Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0070301 cellular response to hydrogen peroxide Biological Process

GO:1900057 positive regulation of leaf senescence Biological Process

GO:1900409 positive regulation of cellular response to oxidative stress Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G32870

ath:AT1G34180

ath:AT1G34190

ath:AT5G04410

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · LXL04_030026 · OH-1004

Cytoplasm0.118

Rank 2 · LXL04_030026 · OH-1004

Cell membrane0.051

Rank 3 · LXL04_030026 · OH-1004

Endoplasmic reticulum0.038

Rank 4 · LXL04_030026 · OH-1004

Plastid0.017

Rank 5 · LXL04_030026 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365.21NAM26-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030026	`PF02365.21`	NAM	26	151	1.8e-47	161.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XIC5`	Arabidopsis thaliana	NAC domain-containing protein 17	41.765%	Swiss-Prot	moderate database homology
`A4FVP6`	Arabidopsis thaliana	NAC domain-containing protein 16	60.816%	Swiss-Prot	weak database homology
`Q84K00`	Arabidopsis thaliana	NAC domain-containing protein 78	62.069%	Swiss-Prot	weak database homology
`F4IED2`	Arabidopsis thaliana	NAC domain-containing protein 13	52.399%	Swiss-Prot	moderate database homology
`Q8H045`	Oryza sativa subsp. japonica	NAC domain-containing protein 54	63.804%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card