LXL04_029917 | RubberDandelionOmics

Gene overview

LXL04_029917

Reference: OH-1004 Chr: Chr06 Coordinates: 103326002-103327112 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

768 bp · LXL04_029917|LXL04_029917|OH1004|cDNA

ATGAGCACAATTGGATTCACAAGTTTCGGTTTAACTTCAAAAACCAGCAAGCTTCCTGTTGTTGCTTCTGCTTGCACCCCTGAAAGACTCGATTCAGAAGAAAATGGGTGCGGGGTTTTGAAAAGAAGAACAGCAATCGTCTCTGGGGCTTCATTGGTTTCTTCAGCAATATTAGGGTTCCCGAGAGAGGGATTGGCCGTCGTCAAACAAGGACTTTTAGCCGGTAGAATTCCAGGCCTTTCTGAACCTAATGAACAAGG...

CDS

Download CDS FASTA

768 bp · LXL04_029917|LXL04_029917|OH1004|CDS

ATGAGCACAATTGGATTCACAAGTTTCGGTTTAACTTCAAAAACCAGCAAGCTTCCTGTTGTTGCTTCTGCTTGCACCCCTGAAAGACTCGATTCAGAAGAAAATGGGTGCGGGGTTTTGAAAAGAAGAACAGCAATCGTCTCTGGGGCTTCATTGGTTTCTTCAGCAATATTAGGGTTCCCGAGAGAGGGATTGGCCGTCGTCAAACAAGGACTTTTAGCCGGTAGAATTCCAGGCCTTTCTGAACCTAATGAACAAGG...

Protein

Download Protein FASTA

255 aa · LXL04_029917|LXL04_029917|OH1004|PROTEIN

MSTIGFTSFGLTSKTSKLPVVASACTPERLDSEENGCGVLKRRTAIVSGASLVSSAILGFPREGLAVVKQGLLAGRIPGLSEPNEQGWRTYRRPDEKSGGHGVGWSPIIPYAFSVPDGWEETPVSIADLGGTEIDLRFGNPSCGRLFVVVAPVLRFADYLEDDAKIEKIGTPEKVINAFGPEVIGENVDGKVVSTQVKEYSGRKYYQFELEPPHCLITATAAGNRLYLFNVLANGLQWKRHNQDLKKISDSFRIV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029917`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029917

Location Chr06:103326002-103327112 (-)

Description Similar to PPD4: PsbP domain-containing protein 4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g77090`	PsbP domain-containing protein 4, chloroplastic.	No verified direct reference in this release
`At3g56650`	May be involved in the redox regulation of photosystem II.	No verified direct reference in this release
`At3g63540`	Thylakoid lumenal 19 kDa protein, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029917 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0048564 photosystem I assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009654 photosystem II oxygen evolving complex Cellular Component

GO:0019898 extrinsic component of membrane Cellular Component

KEGG gene cross-reference

ath:AT1G77090

ath:AT3G56650

ath:AT3G63540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.984

Rank 1 · LXL04_029917 · OH-1004

Mitochondrion0.024

Rank 2 · LXL04_029917 · OH-1004

Nucleus0.014

Rank 3 · LXL04_029917 · OH-1004

Cytoplasm0.013

Rank 4 · LXL04_029917 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_029917 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01789.23PsbP111-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029917	`PF01789.23`	PsbP	111	254	4.5e-12	47.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49292`	Arabidopsis thaliana	PsbP domain-containing protein 4, chloroplastic	76.889%	Swiss-Prot	strong database homology
`Q9LXX5`	Arabidopsis thaliana	PsbP domain-containing protein 6, chloroplastic	32.927%	Swiss-Prot	moderate database homology
`P82658`	Arabidopsis thaliana	Thylakoid lumenal 19 kDa protein, chloroplastic	30.464%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card